KEGG   Canis familiaris (dog): 478755Help
Entry
478755            CDS       T01007                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    478755 (GPD2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     478755 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 Pyr_redox_2 EF-hand_8 FAD_oxidored FAD_binding_2 EF-hand_5 GIDA EF-hand_9 HI0933_like NAD_binding_8 Pyr_redox Thi4 Pyr_redox_3 RNA_pol_Rpb4
Motif
Other DBs
NCBI-GeneID: 478755
NCBI-ProteinID: XP_005640453
Ensembl: ENSCAFG00000009231
LinkDB All DBs
Position
36
AA seq 832 aa AA seqDB search
MAFQKAVKGTILVGGGALASVLGLSQFAHYRRKQVNLAYVEAAECVSEPVNREPPSREAQ
LLTLQNMSEFDILVIGGGATGCGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKEAEPHTGRQRVCGARCRDVLTGTRARGSEHPAWLPRDCIIIFLSLL
LLKPDFRVLLIKFLIVSNDWLNVKIFPRGAWQFFPLCPELQSPRALAALLALAALVHSLS
RGSRGPRRTPAPPHHPPPPSCTDPSYTTCTEHTRPDSGAYRSHKNTAAAARSSCQPSAGV
HIVMPGYFSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTDVTHHPIPSEEDINFI
LNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNHVVDISESGLITIAGG
KWTTYRSMAEDTINAAIKTHNLKAGPSRTVGLFLQGGKDWSPTLYIRLVQDYGLESEVAQ
HLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYGIKEYACTAVDMISRR
TRLAFLNVQAAEEALPRIVELMAKELNWDDYKKEEELETARKFLYYEMGYKSRSEQLTDR
SEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESIGVQMDENTLHEILNEVDLNK
NGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGGL
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcagaaggcagtgaaagggactattcttgttggaggaggtgctcttgcaagt
gttctaggcctctctcaatttgctcattacagaaggaagcaagtgaacctggcctatgtt
gaagcagcagagtgcgtttcagaacctgttaacagggagcctccttccagagaagctcag
ctactgactttgcaaaacatgtctgaattcgatatccttgtcattggaggaggagcaaca
ggatgtggctgtgcactagatgctgtcaccagaggactaaaaacagcccttgtagaaaga
gatgatttctcatcagggaccagcagcagaagcactaaattgatccatggtggtgtgaga
tatcttcagaaggctatcatgaagttggatattgagcagtataggatggtaaaagaagcc
cttcatgaacgtgccaacctactagaaattgctccccatttatcagctccgttgcctata
atgcttccaatttacaagtggtggcagctaccttactactgggtaggaatcaagctatat
gatctggttgcaggaagtaattgcctgaaaagcagttatgtcctcagcaaatcgagagcc
cttgagcatttcccaatgctccagaaggacaaactggtaggagcaattgtctactatgac
ggacaacacaacgacgcacggatgaaccttgccattgccctcactgctgccaggtatggg
gctgccaccgccaattacatggaggtcgtgagcttgctcaaggaggcagagccgcacacg
gggaggcagcgggtgtgtggcgcgcggtgcagggacgtgctcacaggtacgcgggctcgc
gggtctgagcatcctgcctggctgcctagggactgcattataatttttctgtcacttctt
ttattgaagccagatttcagagtcctattaattaaattcctcattgtcagcaatgactgg
cttaacgtgaaaattttccctcgtggtgcttggcaattttttcccctttgtccggagctt
caatcacctcgcgccctcgcggcccttctggccctcgcagccctcgtgcactcgctttcc
cgcggctcccgcggcccccgccgcacccccgcgcccccgcatcatcccccgccgccctct
tgcaccgacccctcgtacaccacgtgtaccgagcacactcggccggattcaggtgcctac
cgcagccacaaaaacacagcggctgctgcgcgctctagctgccagccgagcgccggcgtg
cacatcgtgatgcccggctacttcagcccagagagcatgggacttctcgacccagcaacc
agtgatgggcgagttattttcttcttaccctggcaaaagatgacaatagctggcactacc
gacactccaactgatgtgacacaccatcccattccttcggaagaagatatcaatttcatt
ttgaatgaagtgcgtaactacctgagttgtgatgttgaagtgagaagaggggacgtcctg
gcagcatggagtggtattcgtccccttgttacagatcctaagtctgcagacactcagtcc
atctcccgaaatcatgttgtggatatcagtgagagtggcctcatcactatagcaggtgga
aagtggacaacgtatcgatctatggcagaagacaccataaatgctgccatcaagactcac
aatctgaaagcaggaccaagcagaacagttgggctcttcctgcaaggggggaaggattgg
agccccaccctctacattaggcttgtccaggattatgggcttgaaagtgaggtggcgcag
catcttgccgccacctatggtgacaaggcttttgaggtggccaaaatggcaagtgtaact
ggcaaaaggtggcccatcgttggagtgcgtcttgtgtcagaattcccatacattgaagca
gaggtgaaatatgggattaaggagtatgcctgcacagcagtggatatgatttcacggcgt
actcgcctggccttcctaaacgtccaggcagcagaggaagccctacccaggattgttgaa
ctgatggccaaagagctgaattgggatgattataaaaaagaggaggaacttgaaacagcc
aggaagtttctgtattatgaaatgggctataaatctcgatcagaacagttaacagatcgc
tctgaaattagcctcctgccttcagacatcgacaggtacaagaagagatttcataagttt
gatgcagaccaaaagggctttattactatcgttgatgttcagcgtgtattagagagtatc
ggcgtccaaatggatgagaatacactacacgaaattctgaatgaagtagatctgaacaaa
aatggacaggtcgaactcaatgagtttttgcagctgatgagtgctattcagaaaggaagg
gtgtctggaagccggcttgcgatactaatgaaaactgcagaagagaacctcgacagaaga
gtccccattccagtggaccgaagttgtggaggattgtga

DBGET integrated database retrieval system