KEGG   Canis familiaris (dog): 609914Help
Entry
609914            CDS       T01007                                 

Gene name
GPT
Definition
(RefSeq) glutamic--pyruvic transaminase
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
cfa  Canis familiaris (dog)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    609914 (GPT)
   00220 Arginine biosynthesis
    609914 (GPT)
Enzymes [BR:cfa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     609914 (GPT)
Amino acid related enzymes [BR:cfa01007]
 Aminotransferase (transaminase)
  Class I
   609914 (GPT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
13
AA seq 388 aa AA seqDB search
MALRAGDQVAMNGLKEKVLTLDTMNPCVRRVEYAVRGPIVLRALELEQELRQGVKKPFTE
VVRANIGDAQAMGQKPITFLRQVLALCVHPDLLNSPDFPEDAKRKAERILQACGGHSLGA
YSVSSGIQLIREDVAEYIERRDGGIPSDPNNIYLSTGASDAIVTVLKLLVAGEGPTRTGV
LIPIPQYPLYSAALAELNAVQVDYYLDEERTWALDVAELRRALCQARAHCRPRALCVINP
GNPTGAPPVAPICSRPPPPPTPPHPPWPQERQAVLAELAAKAKLTEQVFNESPGIRCNPV
QGAMYSFPRVQLPPRAVQRAQELSLAPDMFFCMRLLEETGICVVPGSGFGQREGTYHFRM
TILPPMEKLRPLLEKLSQFHAKFTREYS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggccttgagggcaggtgaccaggttgcaatgaacgggctgaaggagaaggtgctgacg
ctggacaccatgaacccgtgtgtgcggagggtggagtatgccgtgcgcggtcccattgtg
ctgcgtgccctcgagctggagcaggagctgcgccagggagtgaagaagcccttcactgag
gtcgtccgcgccaacattggggatgcacaggccatggggcagaagcccatcaccttccta
cgtcaggtcctggccctctgcgtccacccggatctcctgaacagcccggacttccccgag
gatgccaagaggaaggcggagcgcatcttgcaggcatgtgggggacacagcctgggggcc
tacagcgtcagctccggcatccagctgatccgcgaggacgtggctgagtacattgagcgg
cgggacggaggcattccctcggaccccaacaacatctacctgtccactggggccagcgac
gccatcgtgacggtgctgaagctgctggtggccggagagggccccacccgcacaggggtt
ctcatccccatcccgcagtacccgctgtactcggctgctctggccgagctcaacgcggtg
caggtggactactacctggatgaggagcgcacctgggcgctcgacgtggccgagctgcgg
cgcgccctgtgccaggcgcgggctcactgccgcccccgcgcactgtgcgttatcaaccct
ggcaaccccaccggtgcgccgcccgtcgccccaatttgttcccggccccccccacccccc
acccccccccaccccccgtggccgcaggagaggcaggcggtgctggcggagctggcggca
aaggcgaagctcacggagcaggtgttcaacgagtccccgggcatccgctgcaacccggtg
cagggcgccatgtactccttccctcgcgtgcagctgcccccccgcgccgtgcagcgcgct
caggaattgagcctggcccccgacatgttcttctgcatgcgcctcctggaggagaccggc
atctgcgtggtgcccggcagcggcttcgggcagagggaaggcacctaccacttccggatg
accattctgccccccatggagaagctgcggcctctgctggagaagctgagccagttccac
gccaagttcacccgagagtactcctga

DBGET integrated database retrieval system