KEGG   Canis familiaris (dog): 610615Help
Entry
610615            CDS       T01007                                 

Gene name
KMT5A, SETD8
Definition
(RefSeq) lysine methyltransferase 5A
  KO
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
cfa  Canis familiaris (dog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    610615 (KMT5A)
Enzymes [BR:cfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     610615 (KMT5A)
Chromosome [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     610615 (KMT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
26
AA seq 295 aa AA seqDB search
MSPNKCSGMRSPLQEENSVAHHEVKCQGKPLAGLCRKREEKRNSGNAVRSAMKSEEQKLK
DARRGPLAPFPNQKSEAAEPPKTPTSSCDPPITAIAKQALKKPIKGKQAPRKKAQGKTQQ
NRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFS
RGEFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLI
NHSKCGNCQTKLHDIDGVPHLILIASRDIKAGEELLYDYGDRSRASIEAYPWLKH
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagccccaacaaatgctctggaatgcgttccccccttcaggaagagaactcagttgca
catcacgaagtcaaatgccaggggaagccattagctggactctgcaggaaacgagaagag
aaaagaaacagtgggaacgcagtacggagcgccatgaagtctgaggaacagaagctcaaa
gacgccaggagaggtcccctggcaccttttccaaaccaaaaatctgaagcagcagaacct
ccaaaaactccgacctcgtcttgtgatcctcccattacggctatcgccaagcaagccctg
aagaagcccatcaagggcaaacaggctcctcggaaaaaagctcaaggaaaaacacaacag
aatcgcaaactcacggatttctaccccgtgcgaaggagctccaggaagagcaaagctgag
ctgcagtctgaagaaaggaaaagaatagacgagttgattgaaagtgggaaggaagaagga
atgaagattgacctcattgatggcaagggcaggggtgtgatcgccaccaagcagttctcc
cggggcgagtttgtggtagagtaccacggggacctcatcgagatcaccgatgccaagaag
cgggaggctttgtatgcacaagacccctccacgggctgctacatgtactattttcagtat
ctgagcaaaacctactgcgtggatgcaactagagagacaaatcgcctgggaagactgatc
aatcacagtaaatgtgggaactgccaaaccaaactgcacgacattgacggcgtgcctcac
ctcatcctcatcgcctcccgagacatcaaggctggggaggaactcctgtacgactatggg
gatcgcagccgggcttctatcgaagcgtacccctggctgaagcattag

DBGET integrated database retrieval system