KEGG   Canis familiaris (dog): 610668Help
Entry
610668            CDS       T01007                                 

Gene name
ACE, DCP1
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    610668 (ACE)
   04614 Renin-angiotensin system
    610668 (ACE)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    610668 (ACE)
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    610668 (ACE)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     610668 (ACE)
Peptidases [BR:cfa01002]
 Metallo Peptidases
  Family M2
   610668 (ACE)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   610668 (ACE)
CD molecules [BR:cfa04090]
 Proteins
  610668 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
9
AA seq 1315 aa AA seqDB search
MGAAPGRPGRGPLPLPLPLLLLLPLLLPPPPPPAALALDPELQPGNFAADEAGAQLFVQS
FNSSAELVMYQSTVASWAYDTNITEENARRQEEAALLNQEFAEVWGQKAKELYDPIWQNF
SDPVLRRVISGVRTLGPANLPVEKRQQYNALLSNMNRIYSTARVCFYPNKTAICWSLDPE
LTHIMAISRNYALLLYAWEGWHNAVGTPLKPLYQNFTVLSNEAYQKDGFSDTGAYWRSWY
ESPTFVEDLEHLYHQVEPLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWD
NLYDMMVPFPDKPSLDVTSTMVRKGWNTTHMFRVAEEFFTSLGLSPMPPEFWAGSMLEKP
TDGREVVCHASAWDFYNRRDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKEQPVSLRQG
ANPGFHEAIGDVLALSVSTPAHLYKIGLLDNVSNDIESDINFLLKMALEKIAFLPFGYLV
DQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVARNETHFDAGAKFHVPNVTPYIRYF
VSFVLQFQFHQALCKEAGHQGPLHTCDIYQSTQAGAKLREALRAGSSRPWQDVLREAIGS
DTLDAQPLLDYFQPVSRWLQEQNKRNGEVLGWPEYQWRPPMPNNYPQDIGLVTDEVEARR
FVEEYDRRSLVIWNEYAEANWNYNTNITTETSKILLQKNIQMANHTFKFGTWARQFDVTN
FQNASIKRMIKKIQDLERAALPAKELEEYNKILLDMETTYSVASVCHTNGTCLQLEPDLT
NLMATSRKYEDLLWAWKSWREKVGRAILPFFPKYVELANKAARLNGYEDAGDSWRAMYEM
PSLEQDLEQLYQELQPLYLNLHAYVRRALHRHYGPQHINLEGPIPAHLLGNMWGQTWSNI
YDLVVPFPSAPKIDATEAMIKQGWTPKRMFEEANNFFTSLGLLPVPFEFWNKSMLEKPTD
GREVVCHASAWDFYNGKDFRIKQCTTVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGAN
PGFHEAIGDVLALSVSTPKHLHSINLLSSESGGYEQDINFLMKMALDKIAXVPFSYLVDQ
WRWRVFDGSITKENYNQEWWNLRLKYQGLCPPVARSQGDFDPGAKFHVPSSVPYIRYFVG
FVIQFQFHEALCQAAGHKGPLHTCDIYQSKEAGKRLEDAMKLGFSKPWPEAMKLITGQSN
MSASAMMNYFKPLLDWLLTENGRHGEKLGWPQYNWTPNSARSEGPLPGTGRVNFLGLDLE
EQQARVGQWVLLFLGVALLVATLGLTQRLFSIRHHSLRRPHRGPQFGSEVELRHS
NT seq 3948 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgccgggccgtcccgggcgggggccgctgccgctgccgctgccgctgctg
ctgctgctgccgctgctcctgccgccgccgccgccgcccgccgccctggcgctcgacccc
gagctgcagcccggaaactttgccgccgacgaggccggggcgcagctcttcgtgcagagc
ttcaactcgagcgccgagctggtgatgtaccagagcacggtggccagctgggcgtacgac
accaacatcaccgaggagaacgcgcggcgccaggaggaagcggccctgctcaaccaggag
tttgctgaggtctggggccagaaggccaaggagctgtatgacccgatctggcagaacttc
agcgacccagtcctgcgaagagtcatcagtggtgtgcgcaccctgggccctgccaacctg
cctgtggagaagcgtcagcagtacaacgctctgctgagcaacatgaacaggatctattcc
acagccagggtctgcttctaccccaacaagactgccatctgctggtccctggacccagag
ctcacccacatcatggccatctcaagaaactacgccctgctgctctatgcctgggagggc
tggcacaatgctgtgggcaccccgctgaagcccctgtaccagaacttcactgtcctcagc
aatgaggcctaccagaaggatggcttctcagacacaggggcctactggcgctcctggtat
gagtcgcctaccttcgtggaggatctggagcacctctaccatcaagtagagcccctctac
ctgaacctccacgcctacgtccgccgcgcactgcaccgccgatatggagacagatacatc
aacctcaggggacccatcccggctcacctgctgggggacatgtgggcccagagctgggac
aacctctatgacatgatggtgcctttccccgacaagcccagtctcgatgttaccagcact
atggtgcgcaagggttggaacactacgcacatgttccgggtggcagaggagttcttcacc
tccctagggctctcgcccatgcctcctgagttttgggcagggtccatgctggagaaacca
accgacgggcgtgaggtggtgtgccatgcctctgcctgggacttctacaacaggagagac
ttcaggatcaagcagtgcacgcgggttacgatggaccagctgtccacggtgcaccacgag
atgggccatgtgcaatactatctgcagtacaaagagcagcctgtctccctgcgccaaggg
gccaaccccggcttccatgaggccatcggggatgtgttggcgctctccgtctccactcct
gcacatctttacaaaattggcctgctggacaatgtcagcaatgacatagaaagtgacatc
aatttcttgttaaagatggcactggaaaaaattgccttcctgcccttcggctacttggta
gaccagtggcgttggggggtctttagtgggcgtacccccccttcccgctacaactttgac
tggtggtatcttcgaaccaagtatcaggggatctgtcctccagttgcccgaaatgaaacc
cactttgacgccggagctaagtttcacgtcccaaatgtgacaccatacatcaggtacttc
gtcagttttgtcctgcagttccagttccatcaagccctgtgcaaggaggcaggccaccag
ggcccgctgcacacgtgtgacatctaccagtccacccaggcgggggccaagctccgggag
gcactgcgggcaggctcctcaaggccctggcaggacgtgctcagggaggcgattggctca
gacaccctggacgctcaaccactgctcgactacttccagcccgtcagccgatggctgcag
gagcagaacaagcgcaacggcgaggtgctgggatggccagaataccagtggcggccaccg
atgcccaacaattacccacaggacattggcctggtgaccgatgaagttgaggccagaagg
tttgtggaggaatatgaccggagatcgctcgtgatatggaatgaatatgctgaggctaac
tggaactataacaccaatatcaccacagagaccagcaagatcctgctgcagaagaacata
cagatggcaaaccacaccttcaagtttggcacctgggccaggcagtttgacgtgactaac
ttccaaaatgcgagcatcaagcggatgataaagaaaattcaggacctagaacgggcagca
ctccctgccaaggagctggaagagtacaacaagatcctgctggacatggaaaccacttac
agcgtggcctctgtgtgccacaccaacggcacttgtctgcagctggagcctgatctgacg
aatctgatggccacatcccggaaatatgaagatctgctgtgggcctggaagagctggcga
gaaaaagtggggagagcaatcctcccttttttccccaagtacgtggaacttgccaacaag
gctgcccggctcaacggctacgaagatgcaggtgactcctggagagccatgtatgagatg
ccgtccctggagcaagacctggagcagctttaccaggagctgcagccactctacctgaac
ctccacgcctacgtgcgccgggccctgcaccgccactacgggccccagcacatcaacctg
gagggccccattccagctcacctgctggggaacatgtggggtcagacgtggtccaacatc
tatgacttggtggtacccttcccttcagcccccaagatagatgccacagaggccatgata
aagcagggctggactcccaaaaggatgtttgaagaagcgaacaatttcttcacctccctg
gggctgttgcctgtgccctttgagttctggaataagtcaatgctggagaagccgactgat
gggcgggaagtagtgtgccatgcctccgcctgggacttctacaatggcaaggacttcagg
atcaagcagtgcaccactgtgaacatggaggacctggtggtggcccatcacgagatgggc
cacatacagtatttcatgcagtacaaggacttgcctgtgaccttccgggagggcgccaac
cctggctttcatgaggccattggagatgtgctggcactctccgtgtctacccccaagcac
ctccacagcatcaacctgctgagtagcgagagcggtggctacgagcaagacatcaatttt
ctaatgaagatggcgcttgacaagatcgccnttgtgcccttcagctacctggttgaccag
tggcgctggagggtatttgatggaagcatcaccaaggagaactacaaccaggagtggtgg
aacctcaggctgaagtaccagggcctctgccccccagtggcccgttctcaaggggacttt
gacccaggggccaagttccatgttccttcaagtgtgccttatatcaggtactttgttggc
tttgtcattcagttccaattccatgaggctctgtgtcaggcagctggccataagggcccc
ttgcacacgtgtgacatctaccaatctaaggaggccgggaagcgcctggaggatgccatg
aaactgggcttcagtaagccgtggccggaagccatgaagctgatcacgggccagtccaac
atgtctgcatcagccatgatgaactacttcaagccgctgctggactggctgctcacggag
aacgggcggcacggggagaagctgggctggcctcagtacaactggacgcccaactctgct
cgctccgaaggccccttaccgggcaccggccgcgtcaacttcctgggcctggatctggag
gagcagcaggcccgcgtgggccagtgggtgctgctcttcctgggcgtcgccctgctggtg
gccaccttgggcctcacccagcggctcttcagcatccgccaccacagcctccgccggccc
caccgagggccccagtttggctccgaggtggagctgagacactcctga

DBGET integrated database retrieval system