KEGG   Citrobacter farmeri: CI104_19500Help
Entry
CI104_19500       CDS       T05012                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cfar  Citrobacter farmeri
Pathway
cfar00250  Alanine, aspartate and glutamate metabolism
cfar00280  Valine, leucine and isoleucine degradation
cfar00410  beta-Alanine metabolism
cfar00640  Propanoate metabolism
cfar00650  Butanoate metabolism
cfar01100  Metabolic pathways
cfar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cfar00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CI104_19500
   00650 Butanoate metabolism
    CI104_19500
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CI104_19500
   00280 Valine, leucine and isoleucine degradation
    CI104_19500
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CI104_19500
Enzymes [BR:cfar01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CI104_19500
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CI104_19500
Amino acid related enzymes [BR:cfar01007]
 Aminotransferase (transaminase)
  Class III
   CI104_19500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AST81112
UniProt: A0A223JVE5
LinkDB All DBs
Position
3926536..3927819
Genome map
AA seq 427 aa AA seqDB search
MSTNNELMQRRSNAVPRGVGQIHPIFAERAENCRVWDVEGREFLDFAGGIAVLNTGHLHP
QIVSAVEEQLKKLSHTCFQVLAYEPYLQLCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGVSE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAASPAFMQRLRAICDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDITTFAKSIAGGFPLAGVTGRAEVMDAIPPGGLGGTYAG
NPIACAAALAVLNIFEQENLLQKANELGETLRNGLLAIAETHREIGDVRGLGAMIAIELF
EDGDRTRPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIIAQC
FDEAKQR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaataacgaattaatgcagcgtcgtagtaatgccgttccacgcggcgtagga
cagatccacccaatttttgccgagcgtgcggaaaactgtcgggtctgggatgtagaaggc
cgcgaatttctggattttgctggcggcatcgcggtgctgaacacgggacacctgcaccca
cagatcgtctcggcggtcgaagaacagttgaaaaagctgtctcatacctgctttcaggta
ttggcctacgagccatatctgcagctttgcgaaatcatgaaccagaaggtgcctggcgac
ttcgccaagaaaacgctgctggtcaccaccggttctgaagcggtggaaaacgcggtgaag
atcgcgcgcgccgccaccaaacggtcggggaccatcgcctttagcggcgcgtatcacggt
cgcacccactacaccctgtcgttgaccggtaaagtgaacccgtactcagccggaatgggg
ctgatgccgggtcacgtctatcgcgccctctacccgtgcgccctgcacggcgttagtgaa
gacgacgcaatcgccagcattcaccgtatcttcaaaaatgatgctgcaccggaagatatt
gccgccatcgtgattgaaccggtacagggcgaaggcggtttttacgccgcctcgccagcc
tttatgcagcgcctgcgtgcgatttgcgacgaacacgggatcatgctgattgccgatgag
gtacagagcggcgcaggccgtaccggtacgctgttcgcgatggaacagatgggcgtggcg
ccggacatcactaccttcgccaaatctatcgccgggggcttcccgttggcgggggtgacc
ggacgtgcggaggtgatggacgccatccctccgggtgggctgggcggcacctatgccggc
aacccgattgcctgtgccgccgcgctggcagtgctgaacattttcgaacaggaaaatctg
ctgcaaaaagcaaatgagcttggcgaaaccctgcgcaacggcctgctggcgattgccgaa
acgcatcgtgaaatcggcgatgttcgtggactgggggcgatgatcgctatcgagctgttt
gaagacggcgaccgcaccaggccggatgcgaaactgacagcagagatcgtcgctcgcgcc
cgcgacaaagggctgatactgctctcctgcgggccgtactacaacgtgctgcgcatcctt
gttccactcaccattgaagatgcgcaaatccgtcagggtctggagatcatcgcccagtgc
tttgacgaggctaagcaacgttaa

DBGET integrated database retrieval system