KEGG   Citrobacter freundii: CFNIH1_04770Help
Entry
CFNIH1_04770      CDS       T03077                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cfd  Citrobacter freundii
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cfd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CFNIH1_04770 (glpD)
Enzymes [BR:cfd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CFNIH1_04770 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
967276..968784
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGADSVMKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKHTWQARGLVNATGPWVKEFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIDESEINYLLKVYNAHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLSSYYQGIGPAWTKECILPGGDIGGDREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWIIGDATSIAELGEDFGHEFYEAELKYLVEHEWVRRAEDALWRRTKEGMWLNAE
QQSRMTQWLTEYVEKHQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggaggcatcaacggtgccggtatcgcggca
gatgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatttagcctgcgcc
acctcctccgccagctccaaactcatccacggtggcctgcgctacctggaacactacgaa
ttccgcctggtgagcgaggcgctggcagaacgtgaagtgctgttgaaaatggcaccgcat
atcgccttcccgatgcgctttcgtctgccccatcgcccgcatctgcgtccggcatggatg
atccgtattggtttgtttatgtacgatcatctgggcaaacgcaccagtttgccgggttct
actggtttgcgttttggcgcggattccgtaatgaaacctgagattgtgcgcggtttcgaa
tattctgactgctgggtagacgatgcgcgtctggttttggcaaacgcccaaatggtcgtg
cgcaaaggcggagaagtattaacccgcacccgtgccacctccgctcgccgtgaaaacggc
ctgtggatcgttgaagccgaagatatcgataccggcaaaaaacacacctggcaggcgcgc
ggtctggtcaatgccaccggtccgtgggtgaaagagttctttgatgacggcatgcatctg
ccttcgccgtacggtattcgtctgattaaaggtagccacatcgtggtgccgcgcgtacat
acccagaagcaagcgtatattctgcaaaatgaagataaacgtattgtgtttgttatccca
tggatggacgaattctcgatcatcgggacgactgacgtcgaatacaaaggcgacccgaaa
gcagtgaaaattgatgagagcgaaatcaattacctgttgaaggtctacaacgcgcacttt
aagaaacagcttggccgtgacgatatcgtctggacttactcgggcgtgcgtccgctgtgc
gatgacgagtccgactcgccgcaggctattacccgtgattacacgctggatatccacgac
gaaaacggcaaagcgccgctgctgtcggtctttggcggtaagctgacaacctaccgtaag
ctggccgagcacgcgatggaaaaactgtcgtcgtactatcagggcattggcccggcatgg
accaaagagtgcatcctgcctggcggtgatattggcggcgatcgcgaagattacgcggca
aaactgcgccgtcgctatccgttcctgaccgaatcgctggcgcgccactattcgcgtacc
tatggcagcaatactgaatggattatcggcgacgccacatcaattgccgagttaggcgaa
gacttcggccatgagttctatgaggccgagctgaagtatctggttgagcatgagtgggtg
cgtcgcgcagaagatgcgctgtggcgtcgtacgaaagaaggcatgtggctgaatgccgaa
cagcagtcccgcatgacccaatggctgacggagtatgtcgagaagcaccagctgtcgctg
gcctcctga

DBGET integrated database retrieval system