KEGG   Colletotrichum fioriniae: CFIO01_08549Help
Entry
CFIO01_08549      CDS       T04796                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00250  Alanine, aspartate and glutamate metabolism
cfj00280  Valine, leucine and isoleucine degradation
cfj00410  beta-Alanine metabolism
cfj00640  Propanoate metabolism
cfj00650  Butanoate metabolism
cfj01100  Metabolic pathways
Module
cfj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cfj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CFIO01_08549
   00650 Butanoate metabolism
    CFIO01_08549
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFIO01_08549
   00280 Valine, leucine and isoleucine degradation
    CFIO01_08549
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFIO01_08549
Enzymes [BR:cfj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CFIO01_08549
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CFIO01_08549
Amino acid related enzymes [BR:cfj01007]
 Aminotransferase (transaminase)
  Class III
   CFIO01_08549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: EXF80372
UniProt: A0A010QK44
LinkDB All DBs
AA seq 502 aa AA seqDB search
MALLRASASLARPAARAARTPTARRAFCLSAPRMAAAPSLFAGEPSGPALKTDIPGPASK
KATEDLHKVFDTRSLNMLTDYKKSLGNYIADADGNVLLDVYAQIASIPLGYNNPALARVA
QTPEMVNAIINRPALGNFPPEDWAEVLRTGILKVAPKGLDQVFTAMAGSDANETAYKAAF
MWRRQQERGGPDVEFTAEETTSAMNNQSPGASDLSILSFKTGFHGRLFGSLSTTRSKPIH
KLDIPAFDWPQATFPLLKYPLEEHVEENAAAEKAALDEVEHLIKNYHIPPAAVIVEPIQS
EGGDNHASPAFFRGLREVTKKHNVLLIVDEVQTGVGATGKFWAHDHWDLPTPPDMVTFSK
KAQTAGYYFGNPELRPNKPYRQFNTWMGDPARAILFRAIVDEIERLDLVNNTARVGDYLF
GKLEGLASKYPGQFANLRGKGQGTFIAFDNPRRDEFLKKAKGLGINIGGSGESAVRLRPM
LIFQEHHADILIEALEKIVKSW
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggccctcctcagagcctctgcgtccctggcgcgtcccgccgcccgcgcggctcgcaca
cccaccgcgcgcagagcattctgcctttccgctccgcgcatggccgccgccccgagcctg
ttcgccggcgagccctccggcccggccctcaagaccgacattcccggccccgcgtctaag
aaggccaccgaggacctgcacaaggtctttgacacccggagcttgaacatgctcaccgac
tacaagaagagtttgggcaactacattgccgacgccgacggcaacgttctcctcgatgtg
tacgctcaaatcgcttctatccccttgggctacaacaacccggccctcgcaagggtcgcc
cagactcccgagatggtcaacgctatcatcaaccgtcccgctctgggcaactttcccccc
gaagactgggccgaggtcctccgcaccggcatcctcaaggtcgcgcccaagggtctcgac
caggtcttcaccgccatggccggttccgacgcaaacgagacggcctacaaggccgccttc
atgtggcgccgccagcaggagcgcggcggcccggacgtcgagttcaccgcagaggagacc
acctccgccatgaacaaccagtcccccggcgcctccgacctctctatcctctccttcaag
acgggcttccacggtcgccttttcggctccctctccaccacccgctccaagcccatccac
aagctcgacatccccgcctttgactggccccaggcgactttccccttgctcaagtacccg
ctcgaggagcacgtcgaggagaacgccgccgccgagaaggccgccctcgacgaggtggag
cacctcatcaagaactaccacattccccccgccgcggtcatcgtcgagcccatccaatcc
gagggcggcgacaaccacgcctcccccgccttcttccgcggcctccgcgaggtgactaag
aagcacaacgtcctcctcatcgtcgacgaggtccagaccggcgtcggcgccaccggcaag
ttctgggcccacgaccactgggacctccctacccctcccgacatggtcacctttagcaaa
aaggcccagacggcaggctactactttggcaaccccgagctgcgccccaacaagccctac
cgccagttcaacacctggatgggcgacccggcgcgcgccatcctcttccgcgccatcgtc
gacgagattgagcgcctcgacctcgtcaacaacacggcccgcgtcggcgactacctcttt
ggcaagctcgagggcctggcgagcaagtaccccggccaattcgccaacctccgcggaaag
ggccagggcactttcatcgcctttgataacccgcgccgcgacgagttcctcaagaaggca
aagggcctgggcatcaacattggcggatcgggcgagagcgccgtccgtctgaggcccatg
ctcatcttccaggagcaccacgctgatatcctcatcgaggccctggagaagattgtcaag
tcttggtaa

DBGET integrated database retrieval system