KEGG   Camponotus floridanus (Florida carpenter ant): 105252864Help
Entry
105252864         CDS       T03919                                 

Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Peroxisome
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cfo00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    105252864
   04068 FoxO signaling pathway
    105252864
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    105252864
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    105252864
Enzymes [BR:cfo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105252864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 218 aa AA seqDB search
MFAVRRILVSNTIKDIFVRSKHSLPDLPYDYKALEPIISAEIMQLHHSKHHATYVNNLNV
AEEKLKEAAAKGDVNTQIALAPAIKFNGGGHINHSIFWCNLSPCGGDPDATLVKQIEKDF
GSLEELKKRLSETTVAIQGSGWGWLGYDQKAKSLRIATCANQDPLQATTGLIPLFGIDVW
EHAYYLQYKNVRPDYVKAIFDIVNWKDVNARFKTAAGC
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagtaaggcgtattctcgtctccaatacaatcaaggacatatttgtgagatca
aagcactcgcttccagatttaccgtatgattataaagctctagagcccattataagtgca
gaaataatgcagcttcatcattccaaacatcacgcaacatatgtcaataacttgaatgtt
gctgaagagaagttgaaggaagcagctgcaaaaggtgacgtcaatacacaaatcgctcta
gccccagccatcaagtttaatggtggtggtcatatcaatcattcgatcttctggtgtaat
ctttcaccctgtggtggtgatccagatgccaccttggtgaaacagattgagaaggatttt
ggcagtttggaagaattgaaaaaacgtttatctgaaacaactgtggcaattcagggctct
ggctggggttggcttggatatgatcaaaaagcgaagtcgctcagaatagcgacctgtgcg
aatcaggatccgctgcaagccacaactggtcttatacctctctttggtatcgatgtatgg
gaacatgcttattatttgcaatacaagaatgtacgtcccgactatgtgaaagcaatcttt
gacattgtcaattggaaggacgtgaacgcgcgtttcaaaaccgctgccggctgctga

DBGET integrated database retrieval system