Camelus ferus (Wild Bactrian camel): 102505386 Help Entry 102505386         CDS       T02979                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04146   Peroxisome cfr04213   Longevity regulating pathway - multiple species cfr05012   Parkinson disease cfr05014   Amyotrophic lateral sclerosis cfr05016   Huntington disease cfr05020   Prion disease cfr05022   Pathways of neurodegeneration - multiple diseases cfr05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:cfr00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     102505386 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     102505386 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     102505386 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     102505386 (SOD1)    05014 Amyotrophic lateral sclerosis     102505386 (SOD1)    05016 Huntington disease     102505386 (SOD1)    05020 Prion disease     102505386 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     102505386 (SOD1) Enzymes [BR:cfr01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      102505386 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  102505386 NCBI-ProteinID:  XP_032332352 UniProt:  A0A8B8SSA1 LinkDB All DBs Position 1:complement(11710703..11718119) Genome browser AA seq 153 aa AA seqDB search MALKAVCVLKGDGQVQGTIHFEQKENGPVMVSGSISGLAEGDHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPKDQERHVGDLGNVTAGKDGMAIVSIEDPVISLSGDHSIIGRTMVVH EKPDDLGKGGNEESTKTGNAGSRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcgttgaaggctgtgtgcgtgctgaagggcgacggccaggttcagggcaccatccac ttcgagcagaaggaaaatgggccagtcatggtatcggggtccatttcaggattggccgaa ggcgatcatggattccatgtccatcagtttggagataacacacaaggctgtaccagtgca ggtcctcactttaatcctctgtccaaaaaacatggtgggccaaaggatcaagagaggcat gttggagacctgggcaatgtgactgctggcaaagatggtatggccattgtgtctattgaa gatcctgtgatctcactctcaggagaccattccatcattggccgcacaatggtggtccat gaaaaaccagatgacttgggcaaaggtggaaatgaagaaagtacaaagacgggaaatgct ggaagtcgtctggcctgcggcgtgattgggatcgcccaataa

DBGET integrated database retrieval system