Camelus ferus (Wild Bactrian camel): 102516100 Help Entry 102516100         CDS       T02979                                  Symbol CXCL14 Name (RefSeq) C-X-C motif chemokine 14   KO K10033   C-X-C motif chemokine 14 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04060   Cytokine-cytokine receptor interaction cfr04061   Viral protein interaction with cytokine and cytokine receptor cfr04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102516100 (CXCL14)    04061 Viral protein interaction with cytokine and cytokine receptor     102516100 (CXCL14)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102516100 (CXCL14)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102516100 (CXCL14) Cytokines and neuropeptides [BR:cfr04052]  Cytokines   Chemokines    102516100 (CXCL14) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF6355 DUF4863 NinB Motif Other DBs NCBI-GeneID:  102516100 NCBI-ProteinID:  XP_006183627 UniProt:  S9X0Z6 LinkDB All DBs Position 3:complement(94332520..94340708) Genome browser AA seq 99 aa AA seqDB search MRLLTAVLLLLLLALCALLVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITT KSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaggctcctgaccgcagtgctgctcctgctgctcctggcactgtgtgccttgctcgtg gacgggtccaaatgcaagtgctcccggaagggacccaagatccgctacagcgacgtaaag aagctggaaatgaagccaaagtacccgcactgcgaggagaagatggttatcatcaccacc aagagcatgtccaggtaccggggtcaggagcactgcctgcaccccaagctgcagagcacc aagcggttcatcaagtggtacaacgcctggaatgagaagcgcagggtctacgaagaatag

DBGET integrated database retrieval system