KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0681Help
Entry
cg0681            CDS       T00244                                 

Gene name
alr
Definition
(GenBank) ALANINE RACEMASE
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    cg0681 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    cg0681 (alr)
Enzymes [BR:cgb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     cg0681 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cgb01011]
 Precursor biosynthesis
  Racemase
   cg0681 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
600972..602057
Genome map
AA seq 361 aa AA seqDB search
MNLLTTKIDLDAIAHNTRVLKQMAGPAKLMAVVKANAYNHGVEKVAPVIAAHGADAFGVA
TLAEAMQLRDIGISQEVLCWIWTPEQDFRAAIDRNIDLAVISPAHAKALIETDAEHIRVS
IKIDSGLHRSGVDEQEWEGVFSALAAAPHIEVTGMFTHLACADEPENPETDRQIIAFRRA
LALARKHGLECPVNHVCNSPAFLTRSDLHMEMVRPGLAFYGLEPVAGLEHGLKPAMTWEA
KVSVVKQIEAGQGTSYGLTWRAEDRGFVAVVPAGYADGMPRHAQGKFSVTIDGLDYPQVG
RVCMDQFVISLGDNPHGVEAGAKAVIFGENGHDATDFAERLDTINYEVVCRPTGRTVRAY
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgctgaccaccaaaattgacctggatgccatcgcccataacacgagggtgctt
aaacaaatggcgggtccggcgaagctgatggcggtggtgaaggcgaatgcatataaccat
ggcgtagagaaggtcgctccggttattgctgctcatggtgcggatgcgtttggtgtggca
actcttgcggaggctatgcagttgcgtgatatcggcatcagccaagaggttttgtgttgg
atttggacaccggagcaggatttccgcgccgccattgatcgcaatattgatttggctgtt
atttctcccgcgcatgccaaagccttgatcgaaactgatgcggagcatattcgggtgtcc
atcaagattgattctgggttgcatcgttcgggtgtggatgagcaggagtgggagggcgtg
ttcagcgcgttggctgctgccccgcacattgaggtcacgggcatgttcacgcacttggcg
tgcgcggatgagccagagaatccggaaactgatcgccaaattattgcttttcgacgcgcc
cttgcgctcgcccgcaagcacgggcttgagtgcccggtcaaccacgtatgcaactcacct
gcattcttgactcgatctgatttacacatggagatggtccgaccgggtttggccttttat
gggttggaacccgtggcgggactggagcatggtttgaagccggcgatgacgtgggaggcg
aaggtgagcgtcgtaaagcaaattgaagctggacaaggcacttcctatggcctgacctgg
cgcgctgaggatcgcggctttgtggctgtggtgcctgcgggctatgccgatggcatgccg
cggcatgcccaggggaaattctccgtcacgattgatggcctggactatccgcaggttggg
cgcgtatgcatggatcagttcgttatttctttgggcgacaatccacacggcgtggaagct
ggggcgaaggccgtgatattcggtgagaatgggcatgacgcaactgattttgcggagcgt
ttagacaccattaactatgaggtagtgtgccgaccaaccggccgaactgtccgcgcatat
gtttaa

DBGET integrated database retrieval system