KEGG   Cyanobium gracile: Cyagr_1666Help
Entry
Cyagr_1666        CDS       T02359                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cgc  Cyanobium gracile
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgc00001]
   00620 Pyruvate metabolism
    Cyagr_1666
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyagr_1666
   00680 Methane metabolism
    Cyagr_1666
Enzymes [BR:cgc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cyagr_1666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1636003..1639008
Genome map
AA seq 1001 aa AA seqDB search
MRLHLTEPSVVPAEASPGVIRLLTERLELVEDLWQTVLRSECPPEQVDRLLRLKELSGPV
APGLDPEAPSAVDTDGIVALIKAMDLAEGIAAARAFSLYFQLVNILEQHIEEDSYLESIK
RAPAPASNDPFLPPLASQSDPATFRQLFERLRALNVPPGQLEGLLRELDIRLVFTAHPTE
IVRHTVRHKQRRVAALIQKLQVNGQGNPDDNDRLRQQLEEEIRLWWRTDELHQFKPSVID
EVDYALHYFQQVLFDALPQLRQRIRAALAASYPDVQPPRDAFCTFGSWVGSDRDGNPSVT
PDVTWRTACFQRQLMLARYIQSVSVLRDQLSISMQWSQVSAALLESLEMDRLRFPEIYEE
RAARYRLEPYRLKLSYTLERLRLTQQRNQQLAEAGWESPCDGSSGYEAGLSSLMEPAPPQ
ELHYASVEEFRTDLELIKESLDATGLSCEALQDLLSQVHIFAFSLASLDIRQESTRHSDA
IDELSRYLLLPVPYGEMDEEQRVEWLLSELKTRRPLLPPAARWSAPTAETFAVFRMLQRL
QQEFGRRICRTYVISMSHTVSDLLEVVLLAKEAGLVDPMAQKSALLVIPLFETVEDLQGA
PAVMGRLFADPFYRQLLISNSDGEQPLQEVMLGYSDSNKDSGFLSSNWEIHRAQIALQSL
ADAHDVALRIFHGRGGSVGRGGGPAYQAILAQPSGTLKGRIKITEQGEVLASKYSLPELA
LYNLETVTTAVLQNSMVSTPVDDTPTWNVLMERLAARSRDHYRALVHDNPDLVAFFQQVT
PIEEISKLQISSRPARRKSGAKDLSSLRAIPWVFGWTQSRFLLPSWYGVGTALQAELDAD
GEQMELLQLLYQRWPFFRMLISKVEMTLSKVDLELAGHYVTSLGRPQNREVFAQIFEAIA
SEFALTHSLVLRISNHSRLLDGDPALQLSVDLRNRTIIPLGYLQVALLRRLREQKRQPPM
SEGPGDGPGGGGDGRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgcggctccacctgaccgagccttcggtcgttcccgccgaggcctcacccggggtgatc
cgactgctcaccgagcggctggagctggtggaggatctctggcagacggtgctgcgcagt
gaatgcccgcccgagcaggtggatcgtctgctgcggctcaaggaactgagcggtccggtg
gcgccgggcctggatcctgaggccccctccgccgtcgacaccgacggcatcgtggccctg
atcaaggccatggatctggccgagggcatcgccgcagccagggccttctcgctctacttc
cagctggtcaacatcctcgagcagcacatcgaggaggacagctacctcgaaagcatcaag
cgggcccccgcccccgccagcaacgacccgttcctgccgcccctggccagccagagcgat
ccggccaccttccgccagctgttcgagcggctgcgcgccctcaatgtgcccccgggccag
ctggaggggctgctgcgggagctcgacatccggctggtgttcacggcccaccccaccgag
atcgtgcgccacaccgtgcgccacaagcaacggcgggtggcggccctgatccagaagctt
caggtgaacggccagggcaacccggacgacaacgaccggctgcgccagcagctcgaggag
gagatccggctgtggtggcgcaccgacgagctgcaccagttcaagccgtcggtgatcgat
gaggtcgattacgccctccactacttccagcaggtgctcttcgatgccctgccccagctg
cgccagcgcatccgcgccgcccttgccgccagctaccccgacgtgcagcccccccgggac
gccttctgcaccttcggttcctgggtgggatccgaccgggacggcaacccctcggtgacc
ccggacgtgacctggcgcacggcctgcttccagcggcagctgatgctggcccgctacatc
cagtcggtgtcggtcctgcgcgaccagctcagcatctcgatgcagtggagccaggtgagc
gcggccctgctggaatccctcgagatggaccgactgcgcttcccggagatctacgaggag
cgggccgcccgctaccggctcgagccctaccggctgaagctgagctacaccctcgagcgg
ctgcgcctcacccagcagcgcaaccagcagctggccgaggcgggctgggaatccccctgc
gacgggtcctcgggctacgaggccggactgagcagcctgatggagccggccccaccccag
gaactccactacgcctcggtggaggaattccgcaccgacctggagctgatcaaggagagc
ctcgatgccacgggcctgagctgcgaagccctgcaggacctgctcagccaggtgcacatc
ttcgccttctccctggccagcctcgacatccgccaggagagcacccgccacagcgacgcc
atcgatgagctcagccgctacctgctgctgccggtgccctacggcgagatggacgaggag
cagcgggtggagtggctgctgagcgaactcaagacccgccggcccctgctgccgccggcg
gcccgctggagcgcccccaccgccgagaccttcgccgtgttccggatgctgcagcggctg
cagcaggagttcggccggcgcatctgccgcacctatgtgatctccatgagtcacacggtg
tcggacctgctggaggtggtgctgctggccaaggaggccgggctggtggatccgatggcc
cagaaatcggccctgctggtgatccccctgttcgaaacggtagaagacctgcagggggcc
ccggccgtgatggggcggctgttcgccgaccccttctaccgccagctgctgatcagcaac
agcgacggtgagcagcccctgcaggaggtgatgctgggctactccgacagcaacaaggat
tccggcttcctctccagcaactgggagatccaccgggcccagatcgccctgcagtcgctg
gccgatgcccatgacgtggccctgcgcatcttccacggccgcggcggctcggtgggccgg
ggcggcggccccgcctaccaggcgatcctggcccagcccagcggcaccctcaaagggcgc
atcaagatcaccgagcagggggaggtgctggcctccaagtactccctgccggaactggcc
ctctacaacctggaaacggtcaccaccgccgtgctccagaacagcatggtcagcaccccg
gtggacgacacccccacctggaacgtgctgatggagcggctggcggcccgctcccgcgac
cactaccgggccctggtgcacgacaaccccgacctggtggccttcttccagcaggtcaca
ccgatcgaggagatcagcaagctgcagatctccagccggccggcgcggcgcaagagcggc
gccaaggacctctccagcctgcgggccatcccctgggtgttcggctggacccagagccgt
ttcctgctgcccagctggtacggggtggggacggccctgcaggccgagctcgacgccgac
ggcgagcagatggagctgctgcagctgctctaccagcgctggcccttcttccgcatgctg
atctccaaggtggagatgaccctctccaaggtcgacctggagctggccggccattacgtc
acctccctgggacgcccccagaacagggaggtgttcgcccagatcttcgaggcgatcgcc
agtgagttcgccctcacccattccctggtgctgcgcatcagcaaccacagccggctgctg
gacggcgacccggccctgcagctgtcggtcgacctgcgcaaccgcacgatcatccccctg
ggctacctgcaggtggcgctgctgcgccggctgcgggagcagaaacggcagccccccatg
agtgaggggcccggcgacgggccgggaggcggcggcgacggccgcacctacagccgcagc
gaactgctccgcggcgccctgctcaccatcaacggcatcgccgccggcatgcgcaacacg
ggctga

DBGET integrated database retrieval system