Cricetulus griseus (Chinese hamster): 100770067 Help Entry 100770067         CDS       T02813                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge03008   Ribosome biogenesis in eukaryotes cge03013   Nucleocytoplasmic transport cge03250   Viral life cycle - HIV-1 cge05166   Human T-cell leukemia virus 1 infection Brite KEGG Orthology (KO) [BR:cge00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     100770067    03008 Ribosome biogenesis in eukaryotes     100770067   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     100770067  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100770067  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cge03019]     100770067    03009 Ribosome biogenesis [BR:cge03009]     100770067    03016 Transfer RNA biogenesis [BR:cge03016]     100770067    03036 Chromosome and associated proteins [BR:cge03036]     100770067   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cge04147]     100770067    04031 GTP-binding proteins [BR:cge04031]     100770067 Messenger RNA biogenesis [BR:cge03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      100770067 Ribosome biogenesis [BR:cge03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     100770067   Pre-60S particles     100770067 Transfer RNA biogenesis [BR:cge03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     100770067 Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      100770067    Spindle formation proteins     100770067 Exosome [BR:cge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100770067 GTP-binding proteins [BR:cge04031]  Small (monomeric) G-proteins   Ran Family    Ran     100770067 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA ArgoMid G-alpha Motif Other DBs NCBI-GeneID:  100770067 NCBI-ProteinID:  XP_027249548 UniProt:  G3HP89 LinkDB All DBs Position 1 Genome browser AA seq 216 aa AA seqDB search MAAQGEPQVQFKLVLVGDGSTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIK FNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDATSRVTYKNVPNWQRDLVRVCENIPIVLC DNKMDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMP ALAPPEVVMDPASAAQYEHDLEVAQMTALPDEDDDL NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggccgcccagggagagccgcaggtccagttcaagctcgtcctggtgggcgacggcagc accgggaagacgacgttcgtgaagcgccacttgacgggcgagttcgagaagaagtatgta gccaccctgggcgtggaggtgcacccgctcgtcttccacaccaacagaggacccattaaa ttcaacgtgtgggacacagccggccaggaaaagttcgggggcctgcgcgatggctactac atccaagcccagtgtgccattataatgtttgatgcaacatcaagagtcacctacaagaat gtacctaactggcaaagagatctggtccgggtgtgtgaaaacatccccattgtattgtgt gacaataaaatggatattaaggacagaaaagtgaaggcaaaatctattgtcttccaccga aagaagaatcttcagtactatgacatttctgccaaaagtaactacaactttgaaaagcct ttcctctggcttgccagaaagctcattggagaccctaacttggagtttgttgccatgcct gctcttgccccgcctgaggtggtcatggacccagcttcggcagcccagtacgagcatgat ttagaggttgctcaaatgactgcgctccccgatgaggatgatgacctgtga

DBGET integrated database retrieval system