KEGG   Corynebacterium glutamicum R: cgR_1608Help
Entry
cgR_1608          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    cgR_1608
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    cgR_1608
Enzymes [BR:cgt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     cgR_1608
Bacterial toxins [BR:cgt02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   cgR_1608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1783436..1786165)
Genome map
AA seq 909 aa AA seqDB search
MSRRKAVFSALGAAALIGAALPTIPTAQAQTPTGYGFDATASIGEEPEFSTQQLADGGTL
GFDCYRIPSLGVAPNGNVLASWDGRPNNCSDAPQPNSIVGKVSTDNGATWGEQHDISAGI
TAEPKTGYSDPSIVVDWERGDVFNFHVKSFDAGYFTSQPGTDPDDRNVAHVAYAKSSDNG
STWVADTVITDQVVADDTWDSRFATSGNGIQLQYGAYKGRLVQPSVTRMTNGRVAAVAML
SDDHGTTWYPSAPWGNSMDENKIVELSDGTLMNNSRSSGADTYRKVSYSTDGGVTWTEPT
LDTQLPDPRNNASLIRVFPTAPEGSAQAKVLLFSNTATTSGRTNGTVRMSCDDGQTWPVS
KVFEPGAIQYTSMATLPNGDIGMLWENSGSNIDIFYSQFNLSWLEAGCIGVDADETPVTA
GETTTMNVTLTNPFANAIFDRAVSLELPEGWQAEDVRVSIPSGESVTIPVQVTAPLVADN
GELPVEVSILDGADRYTGRLNLTVQGGQEPASTSVKVSIPNLKDTYVAGEKISINFAVNN
PFDVTVNSVPSLGEGENWMPANLRGFDPEQGAPNCRYRNLGANQSYNCTTTTYEVSDSDV
ERGYVDIPTVWTFTNSAGETVWSKNVDVPRIELNGTQDAVTDAIVTVDPINPVHSNGQSQ
TVEVQANVTSEGDLPAGSKVAFYLDSSPIDAAAVDAEGHASISIDVDNIASEQPERTFEV
RARLVVPEDAPRSIARDALARFTVLPEQVQQNSLVIMNHPDVVSDGQTKTIVIAVKATAH
DGSPVAIGTLITFRVNGIERDVVPTNAQGTAKLQLDLKPVNTEDEEYEVTVEAELDELTA
QTTFKVLAGEEEEPTSTEEQPSETEQPSEPEEEPTAPTGSSNGGSFAALLALLAALGGIV
GAVLGLLKL
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
ttgtctcgacgtaaagcagtattctcagcgcttggtgcagccgcactcatcggcgcagca
ctacccaccatcccaacggcccaagctcaaacacccacgggctacggattcgatgcaaca
gcaagcatcggcgaagaaccagagttttcaacacaacaactcgctgacggcggaactctc
ggttttgattgctaccgcatcccatcgcttggcgtcgcacccaacggcaacgtcctcgca
tcgtgggatggtcgcccaaacaactgttcagatgctccgcaacccaactccatcgtgggc
aaggtatcgaccgacaacggagcaacctggggcgaacagcacgacatttccgcaggtatc
accgccgaacccaaaactggctattccgatcccagcatcgttgtggactgggagaggggc
gatgtctttaacttccacgtgaagtcattcgatgcaggatacttcacctcccaaccaggc
acggacccggatgatcgcaacgttgcccatgttgcctacgccaaatcatcagataacggc
tcaacctgggttgcagacaccgtcattactgatcaagtggttgctgatgacacctgggac
agccgatttgccacatccggaaacggcatccaactgcaatacggcgcgtacaaggggcga
ttggttcagccatcggtaactcgcatgaccaatggtcgggtcgcagcagttgccatgctg
agtgatgatcacggcacaacgtggtaccccagtgctccttggggaaactccatggatgaa
aacaaaatcgtggaactcagcgatggaaccctgatgaacaacagtcgttcatcaggagcc
gatacttaccgcaaggtgtcttattccaccgacggcggcgtcacttggaccgagccaact
cttgatacccagctgccggatcctcgcaacaatgcttccctgattcgagtattcccgaca
gcacctgagggaagtgcgcaggcaaaggttctgctgttctccaacactgccaccacgagt
ggccgcaccaatggtaccgtccgcatgtcgtgtgatgatggtcagacctggccggtgtcc
aaggtgtttgaaccaggcgcaatccaatacacctcgatggcaacgcttcccaacggtgac
atcggcatgctgtgggaaaacagtggctcaaatatcgacatcttctactcacagttcaac
ctgtcgtggctggaggccggctgcattggtgtcgacgccgatgaaacgcccgtgactgca
ggtgaaaccaccactatgaatgtcacgttgaccaatcctttcgccaacgcaatttttgac
cgagcagtctcccttgaacttcccgaaggatggcaagctgaggatgttcgtgtgtcgatc
ccatctggagaatctgtcacaatcccagtccaggtcacagcaccgctggtagccgacaac
ggtgaacttccagtggaggtgtccattcttgatggagcagaccgctacacgggtcgtctc
aatctcactgttcagggtgggcaagaacctgcatcaacttcagtgaaggtgagcattcca
aatctcaaggacacttatgtagcaggggagaagatcagcattaactttgcggtcaacaac
ccgtttgacgttacggttaattcggtgccaagcctgggggaaggcgagaactggatgcct
gcaaacctacgcggattcgatccagaacagggtgctccaaactgtcgctacagaaatttg
ggtgcgaaccaaagctacaactgcaccacaactacctatgaagtcagcgattcggatgtg
gaacgcggatatgtcgatattccaacggtatggacctttactaactccgcaggcgaaacg
gtatggtccaaaaacgttgatgtgcctcgaattgaactcaatggaacacaggatgctgtc
actgatgcaatcgtaacggttgatcccatcaacccagttcattccaacggccagagccaa
actgttgaggtccaggctaatgtcacctcagagggagatctgccagctggatctaaggtg
gccttttatctagattcatcacccattgatgccgcagctgttgatgcggaagggcatgcc
agcatctcgattgatgtcgacaacatcgcaagcgagcagcctgaacgcacatttgaggtt
cgcgcccgactcgtcgttccagaagatgcaccacgatcaatcgcgcgtgatgccttggca
cgttttacagtcctccctgaacaagtgcagcagaactccttggtgatcatgaatcatcca
gatgtggtttctgatggacaaacaaagactattgtcatcgcagtgaaggcgacagcacac
gatggatcgccggtggctatcggtactctcattacatttcgcgtcaatggtattgagcgg
gatgtggttccaactaacgcgcaagggaccgcaaagcttcagctagacctcaagccagta
aatactgaagatgaagaatatgaagtaactgttgaagccgagctggatgaattgactgct
cagaccacgttcaaagtacttgctggtgaggaggaggaacccaccagcaccgaagaacaa
ccgtcagaaactgagcagccttctgaacctgaagaggaaccgactgctcctactggaagc
tctaatggtggcagttttgctgcgcttttagcgctgctggcagcgcttggtggcatcgtc
ggtgcagtcctcggattgcttaagttgtag

DBGET integrated database retrieval system