KEGG   Corynebacterium glutamicum R: cgR_1633Help
Entry
cgR_1633          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00620  Pyruvate metabolism
cgt00680  Methane metabolism
cgt01100  Metabolic pathways
cgt01120  Microbial metabolism in diverse environments
cgt01200  Carbon metabolism
Module
cgt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    cgR_1633
  Energy metabolism
   00680 Methane metabolism
    cgR_1633
Enzymes [BR:cgt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     cgR_1633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAF54625
UniProt: A4QEF9
LinkDB All DBs
Position
complement(1815597..1818359)
Genome map
AA seq 920 aa AA seqDB search
MTDFLRDDIRFLGRILGEVIAEQEGQEVYELVEQARLTSFDIAKGNAEMDSLVQVFDGIT
PAKATPIARAFSHFALLANLAEDLHDEELREQALDAGDTPPDSTLDATWLKLNEGNVGAE
AVADVLRNAEVAPVLTAHPTETRRRTVFDAQKWITTHMRERHALQSAEPTARTQSKLDEI
EKNIRRRITILWQTALIRVARPRIEDEIEVGLRYYKLSLLEEIPRINRDVAVELRERFGE
DVPLKPVVKPGSWIGGDHDGNPYVTAETVEYSTHRAAETVLKYYARQLHSLEHELSLSDR
MNKVTPQLLALADAGHNDVPSRVDEPYRRAVHGVRGRILATTAELIGEDAVEGVWFKVFT
PYASPEEFLNDALTIDHSLRESNDTLIADDRLSVLISAIESFGFNLYSLDLRQNSESYED
VLTELFERAQVTANYRELSEEEKLEVLLKELRSPRPLIPHGSDEYSEVTDRELGIFRTAS
EAVKKFGPRMVPHCIISMASSVTDVLEPMVLLLKEFGLIAANGDNPRGTVDVIPLFETIE
DLRAGAGILGELWKIDLYRNYLLQRDNVQEVMLGYSDSNKDGGYFSANWALYDAELQLVE
LCRSAGVKLRLFHGRGGTVGRGGGPSYDAILAQPKGAVQGSVRITEQGEIISAKYGNPET
ARRNLEALVSATLEASLLDVSELTDHQRAYDIMSEISELSLKKYTSLVHEDQGFIDYFTQ
STPLQEIGSLNIGSRPSSRKQTSSVEDLRAIPWVLSWSQSRVMLPGWFGVGTALEQWIGE
GEQATQRIAELQTLNESWPFFTSVLDNMAQVMSKAELRLAKLYADLIPDREVAERVYSVI
HEEYFLTKKMFCVITGSDDLLDDNPLLARSVQRRYPYLLPLNVIQVEMMRRYRKGDQSEQ
VSRNIQLTMNGLSTALRNSG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgactgattttctacgcgatgacatcaggttcctcggtcgaatcctcggtgaggtaatt
gcggaacaagaaggccaggaggtttatgaactggtcgaacaagcgcgcctgacttctttt
gatatcgccaagggcaacgccgaaatggatagcctggttcaggttttcgacggcattact
ccagccaaggcaacaccgattgctcgcgcattttcccacttcgctctgctggctaacctg
gcggaagacctccacgatgaagagcttcgtgaacaggctctcgatgcaggcgacacccct
ccggacagcactcttgatgccacctggctgaaactcaatgagggcaatgttggcgcagaa
gctgtggcggatgtgttgcgtaatgctgaggtggcgccagttctgactgcgcacccaact
gagactcgccgccgcactgtttttgatgcgcaaaagtggatcaccacccacatgcgtgaa
cgccacgctttgcagtctgcggagccaaccgctcgtacgcaaagcaagttggatgagatc
gaaaagaacatccgccgtcgcatcaccattttgtggcagaccgcgttgattcgtgtggcc
cgcccacgtatcgaggacgagatcgaagtagggctgcgctactacaagctgagccttttg
gaagagattccacgtatcaaccgtgatgtggctgttgagcttcgtgagcgtttcggcgag
gatgttcctttgaagcccgtggtcaagccaggttcctggattggtggagaccacgacggt
aacccttatgtcaccgcggaaacagttgagtattccactcaccgcgctgcggaaaccgtg
ctcaagtactatgcacgccagctgcattccctcgagcatgagctcagcctgtcggaccgc
atgaataaggtcaccccgcagctgcttgcgctggcagatgccgggcacaacgacgtgcca
agccgcgtggatgagccttatcgacgcgccgtccatggcgttcgtggccgtatcctcgcg
acgacggctgagctgatcggcgaggacgccgttgagggcgtgtggttcaaggtctttact
ccatacgcatccccggaagaattcttaaacgatgcgttaaccatcgatcattctctgcgt
gaatccaatgacactctcatcgccgatgatcgtttgtctgtgctgatttctgccatcgag
agcttcggattcaacctctactcactggatctgcgccagaactctgagagctacgaagac
gtactcacagagcttttcgagcgtgcccaagtcaccgcaaactaccgcgagctgtctgaa
gaggagaagcttgaggtgctgctgaaggaactgcgcagccctcgtccgttgatcccgcac
ggttcagatgaatacagcgaggtcaccgaccgcgagctcggtatcttccgcaccgcgtcg
gaagctgtcaagaaattcggcccacgcatggtgcctcactgcatcatttccatggcatca
tcggtcaccgatgtgctcgagccgatggtgttgttgctcaaagaattcggcctcatcgcg
gccaacggcgacaatccacgcggcaccgtcgatgtcatcccactgttcgaaaccatcgaa
gaccttcgagccggcgccggtattctcggcgaactgtggaaaattgatctctaccgcaac
tacctcctgcagcgcgacaacgtccaggaagtcatgctcggctactccgattccaacaag
gatggcggatatttctccgcaaactgggcgctttacgacgcggaactgcagcttgtcgaa
ctatgccgatcagccggggtcaagcttcgcctgttccacggccgcggtggcaccgttgga
cgtggtggcggaccttcctacgatgcgattcttgcccagcccaagggggctgtccaaggt
tccgtgcgcatcaccgagcagggcgaaatcatctcagctaagtacggcaaccctgaaact
gcgcgccgaaacctcgaggcactggtctcagccacgcttgaggcatcgcttctcgacgtc
tctgaactcaccgatcaccaacgcgcgtatgacatcatgagtgagatctctgagctcagc
ctgaagaagtacacctccttggtgcacgaggatcaaggcttcatcgattacttcacccaa
tccacaccactgcaggagatcggatccctcaacatcggatccaggccttcctcacgcaag
caaacttcctctgtggaagatttgcgagccatcccatgggttcttagctggtcacagtct
cgtgtgatgctgccaggatggtttggtgtcggaacggcacttgaacagtggattggagaa
ggggagcaagctacccagcgcatcgcagagctgcaaacactcaacgagtcctggccattt
ttcacctcagtgttggacaacatggctcaggtgatgtccaaggcagagctgcgtttggca
aagctctatgcagacctcatcccagatagggaagtcgccgagcgcgtctattccgtcatc
cacgaggaatatttcctgactaaaaagatgttctgcgtgatcaccggctccgatgatctc
cttgatgacaacccacttctggcacgctctgtccagcgtcgttacccctacctgcttcca
ctcaatgtgatccaggtagagatgatgcgacgctaccgaaaaggcgaccaaagcgagcaa
gtgtcccgcaatattcagctgacaatgaacggtctttccactgcactgcgcaactccggc
tag

DBGET integrated database retrieval system