KEGG   Corynebacterium glutamicum K051: WA5_0480Help
Entry
WA5_0480          CDS       T02508                                 

Gene name
Tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
cgu  Corynebacterium glutamicum K051
Brite
Translation factors [BR:cgu03012]
 Eukaryotic Type
  Elongation factors
   WA5_0480 (Tuf)
 Prokaryotic Type
   WA5_0480 (Tuf)
Mitochondrial biogenesis [BR:cgu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    WA5_0480 (Tuf)
Exosome [BR:cgu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   WA5_0480 (Tuf)
  Exosomal proteins of breast cancer cells
   WA5_0480 (Tuf)
  Exosomal proteins of colorectal cancer cells
   WA5_0480 (Tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
526376..527566
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADTYPELNEAFAFDSIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVEDEEIIELVEMEVRELLAEQDYDEEAPIVHISALKAL
EGDEKWGKQILELMQACDDNIPDPVRETDKPFLMPIEDIFTITGRGTVVTGRVERGTLNV
NDDVDIIGIKEKSTSTTVTGIEMFRKLLDSAEAGDNCGLLLRGIKREDVERGQVIVKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgtaccaagccccacgtaaacatcggcaccatcggtcac
gttgaccacggtaagaccaccaccaccgcggctatcaccaaggttctggctgacacttac
cctgagctcaacgaggctttcgccttcgactccatcgataaggctcctgaggagaaggag
cgtggcatcacgatcaacatctcccacgttgagtaccagactgaaaagcgccactacgca
cacgttgacgctccaggccacgccgactacatcaagaacatgattaccggcgctgctcag
atggacggcgcaatcctcgttgttgctgctaccgacggcccaatgcctcagacccgtgag
cacgttcttcttgctcgccaggttggcgttccttacatcctcgttgctcttaacaagtgc
gacatggttgaggatgaggaaatcatcgagctcgtcgagatggaagttcgtgaacttctt
gctgagcaggactacgacgaagaggctccaattgttcacatctccgctctgaaggctctt
gagggcgacgagaagtggggcaagcagatccttgagctcatgcaggcttgcgatgacaac
atccctgacccagttcgtgagaccgacaagccattcctcatgcctatcgaggacatcttc
accatcaccggtcgtggcaccgttgttaccggtcgtgttgagcgcggtaccctgaacgtg
aacgatgatgttgacatcatcggcatcaaggagaagtccacctccaccaccgttaccggt
atcgagatgttccgtaagcttcttgactccgctgaggctggcgacaactgtggtctgctt
ctccgtggtatcaagcgcgaagatgttgagcgtggccaggttatcgttaagccaggcgct
tacacccctcacaccgagttcgagggctctgtctacgttctgtccaaggatgaaggtggc
cgccacaccccattcttcgacaactaccgtcctcagttctacttccgcaccaccgacgtt
accggtgttgtgaagcttccagagggcaccgagatggtcatgcctggcgacaacgtcgac
atgtccgtcaccctgatccagcctgtcgctatggacgagggcctgcgtttcgctatccgc
gaaggctcccgcaccgttggcgctggtcgtgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system