KEGG   Corynebacterium glutamicum K051: WA5_1495Help
Entry
WA5_1495          CDS       T02508                                 

Gene name
NanH
Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cgu  Corynebacterium glutamicum K051
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cgu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    WA5_1495 (NanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    WA5_1495 (NanH)
Enzymes [BR:cgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     WA5_1495 (NanH)
Bacterial toxins [BR:cgu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   WA5_1495 (NanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1644314..1645513)
Genome map
AA seq 399 aa AA seqDB search
MLPIWMGLPFKKAGALSRRKAVFSALGAAALIGAALPTIPTAQAQTPTGYGFDATASISE
EPEFSTQQLADGGTLGFDCYRIPSLGVAPNGNVLASWDGRPNNCSDAPQPNSIVGKVSTD
NGATWGEQHDISAGITAEPKTGYSDPSIVVDWERGDVFNFHVKSFDAEYFTSQPGTDPDD
RNVAHVAYAKSSDNGSTWVADTVITDQVVADDTWDSRFATSGNGIQLQYGAYKGRLVQPS
VTRMTNGRVAAVAMLSDDHGATWYPSAPWGNSMDENKIVELSDGTLMNNSRSSGADTYRK
VSYSTDGGVTWTEPTLDTQLPDPRNNASLIRVFPTAPEGSAQAKVLLFSNTATTSGRTNG
TVRMSCDDGQTWPVSKVFEPGAIQYTSMATLPNGDIGML
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaatctggatgggtcttccattcaagaaagcaggtgctttgtctcggcgtaaa
gcagtattctcagcgcttggtgcagccgcactcatcggcgcagcactacccaccatccca
acggcccaagctcaaacacccacgggctacggattcgatgcaacagcaagcatcagcgaa
gaaccagagttttcaacacaacaactcgctgacggcggaactctcggatttgattgctac
cgcatcccatcgcttggcgtcgcacccaacggcaacgtcctcgcatcgtgggatggtcgc
ccaaacaactgttcagatgctccacaacccaactccatcgtgggcaaggtatcgaccgac
aacggagcaacctggggcgaacagcacgacatttccgcaggtatcaccgccgaacccaaa
actggctattccgatcccagcatcgttgtggactgggagaggggcgatgtctttaacttc
cacgtgaaatcattcgatgcagaatacttcacctcccaaccaggcacggacccggatgat
cgcaacgttgcccatgttgcctacgccaaatcatcagataacggctcaacctgggttgca
gacaccgtcattactgatcaagtggttgctgatgacacctgggacagccgatttgccaca
tccggaaacggcatccaactgcaatacggcgcgtacaagggacgattggtccagccatcg
gtaactcgcatgaccaatggtcgagtcgcagcagttgccatgctgagtgatgatcacggc
gcaacgtggtaccccagtgctccttggggaaactccatggatgaaaacaaaatcgtggaa
ctcagcgatggaaccctgatgaacaacagtcgttcatcaggagccgatacttaccgcaag
gtgtcttattccaccgacggcggcgtcacttggaccgagccaactcttgatacccagctg
ccggatcctcgcaacaatgcttccctgattcgagtattcccgacagcacctgagggaagt
gcgcaggcaaaggttctgctgttctccaacactgccaccacgagtggccgcaccaatggc
accgtccgcatgtcgtgtgatgatggtcagacctggccggtgtctaaggtgtttgaacca
ggagcaatccaatatacctcgatggcaacgcttcccaacggtgacatcggcatgctgtga

DBGET integrated database retrieval system