KEGG   Corynebacterium glutamicum B253: SB89_03160Help
Entry
SB89_03160        CDS       T03668                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cgx  Corynebacterium glutamicum B253
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cgx00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SB89_03160
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SB89_03160
Enzymes [BR:cgx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SB89_03160
Peptidoglycan biosynthesis and degradation proteins [BR:cgx01011]
 Precursor biosynthesis
  Racemase
   SB89_03160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
662895..663980
Genome map
AA seq 361 aa AA seqDB search
MNLLTTKIDLDAIAHNTRVLKQMAGPAKLMAVVKANAYNHGVEKVAPVIAAHGADAFGVA
TLAEAMQLRDIGISQEVLCWIWTPEQDFRAAIDRNIDLAVISPAHAKALIDTDAEHIRVS
IKIDSGLHRSGVDEQEWEGVFSALAAAPHIEVTGMFTHLACADEPENPETDRQIIAFRRA
LALARKHGLECPVNHVCNSPAFLTRSDLHMEMVRPGLAFYGLEPVAGLEHGLKPAMTWEA
KVSVVKQIEAGQGTSYGLTWRAEDRGFVAVVPAGYADGMPRHAQGKFSVTIGGVDYPQVG
RVCMDQFVISLGDNPHGVEAGAKAVIFGENGHDATDFAERLGTINYEVVCRPTGRTVRAY
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgctgaccaccaaaattgacctggatgccatcgcccataacacgagggtgctt
aaacaaatggcgggtccggcgaagctgatggcggtggtgaaggcgaatgcatataaccat
ggcgtggagaaggtcgctccggttattgctgctcatggtgcggatgcgtttggtgtggca
actcttgcggaggctatgcagttgcgtgatatcggcatcagccaagaggttttgtgttgg
atttggacaccggaacaggatttccgcgccgccattgatcgcaatattgatttggctgtt
atttctcccgcgcatgccaaagccttgatcgacactgatgcggagcatattcgggtgtcc
atcaagattgattctgggttgcatcgttcgggtgtggatgagcaggagtgggagggcgtg
ttcagcgcgttggctgctgccccgcacattgaggtcacgggcatgttcacgcacttggcg
tgcgcggatgagccagagaatccggaaactgatcgccaaattattgcttttcgacgcgcc
cttgcgctcgcccgcaagcacgggcttgagtgcccggtcaaccacgtatgcaactcacct
gcattcttgactcgatctgatttacacatggagatggtccgaccgggtttggccttttat
gggttggaacccgtggcgggactggagcatggtttgaagccggctatgacgtgggaggcg
aaggtgagcgtcgtaaagcaaattgaagctggacaaggcacctcttatggcctgacctgg
cgcgctgaggatcgcggctttgtggctgtggtgcctgcgggctatgccgatggcatgccg
cggcatgcccaggggaaattctccgtcacgattggtggcgtggactatccgcaggttggg
cgcgtatgcatggatcagttcgttatttctttgggcgacaatccacacggcgtggaagct
ggcgcgaaggccgtgatattcggtgagaatgggcatgacgcaactgattttgcggagcgt
ttaggcaccattaactatgaggtagtgtgccgaccaaccggccgaactgtccgcgcatat
gtttaa

DBGET integrated database retrieval system