KEGG   Corynebacterium humireducens: B842_04710Help
Entry
B842_04710        CDS       T03576                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
chm  Corynebacterium humireducens
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:chm00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    B842_04710
Enzymes [BR:chm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     B842_04710
DNA repair and recombination proteins [BR:chm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     B842_04710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
936245..938629
Genome map
AA seq 794 aa AA seqDB search
MARGRKQFQVGERTLSVSNLDKVLYPATGTTKADVIHYYLSVAEVIIPQLTRRPVTRKRW
VDGVGTEEEPGQVFFRKDLEDSAPSWIPTGRIAHKTSTNHYPLAEEPGVLAWFGQVAALE
LHAPQWRFGANGQPRNPDRLVLDLDPGEGVGLRDYAALDGTHNSETISQVARELARGLES
DHPDEVISTMKTADRAGKVFIDWSQNNASKTTVSPYSLRGRLRPTVAAPRTWEELADPDL
RHLEYEEVLERVAEGLDPLEPLRADPSETPDRLSTYRSMRDPSKTAEPVPEERPTARADG
EPTFVIQEHHARRLHWDFRLEHDGVLVSWAVPKGPPLDPSLNRLAVQTEDHPLEYGTFEG
IIAKGEYGAGEVSIWDAGTCEIEKWRAGKEVIAVLHGRPDGGLGGVPRRYALIHAPGMGE
EKHWLLKFMKDQPDDASRRPADPAPSEKAEVAESPAARPAFGVADLPSPMLATPGTPADI
KLGVQDGEEWVFEMKWDGYRIIAGVGVGTGDGRVVLASRNGHDYTALFPQAGELVELLQG
PAAEAGGAVFDGELVALDDRGRPDFGLLQAAAKGEAGDVTLRYMVFDILQLGAPGDQDAS
PQLRTPYRQRRELLREVLAEGEHVTVPPAHTGSLAQAEKISRELALEGLVAKRADSTYLP
GKRGKAWLKLKTQLHQEVVVIGARHGKGGRAGGIGSLLLAVPDADGQLRYAGRVGTGFTA
AQLGDIEKTLRRIERKTPPVDDVPAADQSDAWFVTPKLVGEVSLAGRTREGRVRQAAWRG
WRADKSPDEVRWEV
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgaggcaggaagcagtttcaggtcggcgagcgcacgctgtcggtgagcaacctc
gacaaggtgctttacccggccacgggcacgacgaaggccgatgtcatccactactacctc
agcgtcgccgaggtgatcatcccgcagctcacccgccgtcccgtcacccgtaaaaggtgg
gtcgacggggtcggcaccgaggaagagccggggcaggtgttcttccgcaaggatctggag
gattcggcgcccagctggatcccgaccggcaggatcgcgcacaagacctccaccaaccac
tacccgctggccgaggaaccgggcgtcctggcctggttcgggcaggtcgccgccctcgag
ctccacgccccgcagtggcgtttcggcgccaacggccagccccgcaaccccgaccggctg
gtgctcgacctcgacccgggcgagggggtggggctgcgcgactacgcggcgctcgacggc
acccacaactccgagacgatctcccaggtggcccgcgaactggcccgcggcctggagtcc
gatcacccggatgaggtgatctccacgatgaagacggccgaccgcgccgggaaggtgttc
atcgactggtcgcagaacaacgcctccaagaccaccgtcagcccgtactccctgcgcggt
cgcctgcggcccacggtcgccgcaccccgtacctgggaggagctggcggacccggacctg
cggcacctcgagtacgaggaggtcctcgagcgggtcgccgaggggcttgatccgctggag
cccctgcgcgccgacccctccgagacccccgaccggctgagcacctaccgctccatgcgc
gatccctcgaagacggcggagccggtgccggaggagcggccgacggcgcgtgcggacggt
gagccgaccttcgtcatccaggagcaccacgcccgccgcctgcactgggatttccgcctc
gagcacgacggggtgctcgtctcctgggcggtaccgaagggcccgccgctggacccctcc
ctcaaccgcctggccgtgcagaccgaggaccatcccctggagtacggcaccttcgagggg
atcatcgcgaagggggagtacggcgccggcgaggtgagcatctgggatgcgggcacctgc
gagatcgagaagtggcgcgcgggcaaggaggtcatcgccgtcctgcacggccgccccgac
ggtgggctgggtggtgtgccgcgccgctacgccctcatccacgccccgggcatgggggag
gagaagcactggttgctgaagttcatgaaggatcagcccgacgatgcttctcgacgcccc
gccgatcccgctcccagcgagaaggctgaggtcgctgagtcccctgccgcccgcccggcg
ttcggcgtcgcggacctgccgtccccgatgctcgccaccccgggcaccccggccgacatc
aagctcggcgtgcaggacggggaggagtgggtcttcgagatgaagtgggacggctaccgc
atcattgcgggagtgggcgtcgggacgggggacggccgggtggtgttggccagccgcaac
ggtcacgactacacggcgctgttcccgcaggctggggagctggtggagctgctgcagggc
ccggccgcggaggccggtggggcggtgttcgacggggagctggtggccctcgacgaccgc
ggccgccccgacttcgggctgctgcaggccgccgccaagggggaggccggggacgtgacg
ttgcgctacatggtcttcgacatcctccagctcggcgcgccgggtgaccaggacgcgagt
ccgcagctgcggactccgtaccgtcagcgccgcgaactcctgcgcgaggtgctggcggag
ggtgagcacgtcaccgtccctcccgcgcacaccgggagcctggcccaggcggagaagatc
agccgcgagctggcgctggaggggctggtggccaaacgcgccgactctacctacctgccc
ggtaagcggggcaaggcgtggctgaagctgaagacgcagctgcaccaggaggtggtggtg
atcggtgcccgccacggcaagggcgggcgcgccggcgggatcggttcgctgctgctggcg
gtgccggacgccgacggtcagctgcgctacgccggccgcgtcggcaccggcttcaccgcc
gcgcagctgggggacatcgagaagaccctgcgccggatcgagcgcaagaccccgccggtc
gacgacgtgccggcggcggaccagtccgacgcgtggttcgtcaccccgaagcttgtcggg
gaggtgtccctggcaggccggacgcgtgaggggcgggtacgccaggccgcgtggcgcggg
tggcgtgcggacaagagccccgacgaggtgcgctgggaggtgtag

DBGET integrated database retrieval system