KEGG   Corynebacterium halotolerans: A605_02895Help
Entry
A605_02895        CDS       T02472                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
chn  Corynebacterium halotolerans
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:chn00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A605_02895 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A605_02895 (alr)
Enzymes [BR:chn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A605_02895 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:chn01011]
 Precursor biosynthesis
  Racemase
   A605_02895 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
619526..620623
Genome map
AA seq 365 aa AA seqDB search
MDLLTARIDLDAIAHNTRLLKDLVGEARLMAVVKADGYGHGATEVAPVMAANGADAFGVA
TLAEAVELRESGIETPILAWIWSPHQDVAEALALNIELGVPSLEHARALVAAEVPARVCV
KVDTGLHRSGVDEAEWDEVFTTLRDAAHLTVTGVFSHLSCADEPDNPETDRQAERFRRAI
ARARELGLEVPVNHLCNSPGALTRADLHFGQVRVGVALYGQEPVPGLDHGLKPAMTWVGR
VAVVKPIAPGEGTSYGLTWHAERAGRLAVIPCGYADGLPRMVQGHLEVGIGGKRYPQVGR
VCMDQIVVDLGDNAADVRPGDEAVIFGAGGMSATELAEATGTINYEIICLPTGRTVRTYT
GGDQQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggacctgttgaccgcccgcatcgatctcgacgccatcgcccacaacacccgcctgctc
aaggacctggtgggggaggcgcgcctgatggccgtggtcaaggccgacggctacggccac
ggcgccaccgaggtcgcccccgtcatggccgccaacggcgccgacgccttcggggtcgcc
accctcgccgaggccgtcgagctgcgcgagtccggcatcgagacccccatcctcgcctgg
atctggtcaccccaccaggacgtcgccgaggcgctggcactgaatatcgagctcggcgtg
ccctcgctggagcacgcccgcgcgctggtcgccgccgaggtgcccgcccgcgtctgcgtc
aaggtcgataccggcctgcaccgttccggggtcgacgaggccgagtgggacgaggtcttc
accaccctgcgcgacgccgcgcacctgaccgtcaccggcgtattctcccacctgtcctgc
gccgacgagcccgataacccggagaccgaccggcaggccgagcgcttccgccgggcgatc
gcccgcgcccgggaactcggcctcgaggtgcccgtcaaccacctgtgcaactcacccggc
gccctgacgcgggcggacctgcacttcgggcaggtccgggtgggcgtggccctctacggc
caggagccggtcccggggctcgaccacggcctgaagcccgcgatgacctgggtgggccgg
gtggcggtggtcaagccgatcgcgccgggggagggcacgagctacggcctgacctggcac
gccgagcgggccggccggctcgccgtcattccctgcggctacgcggacgggttgccgcga
atggtgcaggggcacctggaggtcggtatcggcgggaagcgctacccgcaggtcggccgg
gtgtgcatggaccagatcgtcgtcgacctgggcgacaacgccgccgacgtccgccccggg
gacgaggccgtcatcttcggtgccggcggcatgtccgccaccgagctggccgaggccacc
ggcaccatcaactacgagatcatctgcctgcccaccggccgcacggtgcgcacctacaca
ggaggcgaccagcagtga

DBGET integrated database retrieval system