KEGG   Chryseobacterium sp. T16E-39: CEY12_12005Help
Entry
CEY12_12005       CDS       T04952                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
chry  Chryseobacterium sp. T16E-39
Pathway
chry03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:chry00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CEY12_12005 (ligD)
Enzymes [BR:chry01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CEY12_12005 (ligD)
DNA repair and recombination proteins [BR:chry03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CEY12_12005 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_ligase_OB_2 GH3
Motif
Other DBs
NCBI-ProteinID: ASK30791
UniProt: A0A220SBC1
LinkDB All DBs
Position
2657062..2658933
Genome map
AA seq 623 aa AA seqDB search
MLAKSFEKAFDDQDWIFEIKWDGYRAIADLSHKAHLLYSRNGISFLAKFEKITQDFDQQK
HTMILDGEIVAYDEKGKPNFQLLQQIGDNPNLALVYQVFDLLWLNGHSTEELPLLQRKEL
LKEALVETEVIKYCDHIPEKGIEFFDQMKKMQLEGMIAKKTDSLYIENHRTSDWLKIKFT
NTEEAIICGFTEPRGSREGFGALILGKYNQGKLIYSGHTGTGFNKETLTQLHQQLKKLII
KSTPFDSAPKTNMPVTWVQPKLVCEIKYSEITKDGIFRHPVFIAIRQDKNPEEINDSTNK
MDQPNEKPKRMKAKTPSKNTEKEITLDKHKVKLTNQDKIYFPEDGITKGDVIDYYQSIAK
YILPYLKNRPLSLNRFPNGIEEQGFYQKDASDNIPEWIKTTEVYSESNDKYIDYIYCNDK
ATLAYLNNLGCIDLNPWNSSIPDLEHPDYLVLDLDPSKKNTFDDVIETALQVNEVLLSIK
VKGYCKTSGSTGIHIYIPMGAKYEFDQVKDFAHIVMKQVNEKLPKITTLERSLQKRDDKK
IYLDYLQNRTGQTLASAYSLRPKQGASVSMPLDWNDVKPGLKPTDFNIHNSLERIKENGD
LFKPVLGKGIDMMKALELLQNLK
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcaaaatcatttgaaaaggcgttcgatgatcaggactggatttttgagatcaag
tgggacggctacagggctattgctgatttaagccataaagctcatctgctttattcaaga
aatgggatttcttttctggcgaaatttgagaaaattactcaggattttgaccaacaaaaa
catacaatgattctggatggcgaaatcgtagcttatgatgaaaaagggaaacctaatttc
caattactgcaacagattggagataatcccaatcttgctctcgtttatcaggtttttgat
ttactttggctgaatggtcattctacggaagagctcccgttattgcaaagaaaagaactg
ttaaaagaagcattagttgaaacagaagtgatcaaatactgcgaccatattccggaaaaa
ggaattgaattttttgatcagatgaaaaagatgcagctggaaggaatgattgcaaagaag
accgacagtctatacattgaaaatcacaggacttctgactggctaaaaattaaatttacc
aataccgaagaggctatcatctgcggatttacagaaccgagaggttcaagagaaggattt
ggagccctgattttaggaaaatataatcagggaaaactaatttattcgggacacacaggt
acaggatttaataaagaaactttgacgcagcttcatcagcagttgaaaaaattaattata
aaaagtactccatttgactctgctcccaaaacaaatatgcccgtaacatgggtacagcct
aaacttgtctgcgaaattaaatactctgaaattactaaagacggaatctttagacatcca
gtttttattgccattcgccaggataaaaatcctgaggaaattaacgattcaactaataaa
atggatcaaccaaacgaaaaacctaaaagaatgaaagccaagactccatcaaaaaacacc
gaaaaagaaattactttggataaacataaagtaaaattaaccaatcaggataagatctat
ttcccggaagatggcatcactaagggagatgtgattgattattatcagtcaatagctaaa
tacatattaccctatctcaaaaatcgtcctctgtcactgaaccgttttccaaatggaatt
gaggagcagggtttttatcaaaaagatgccagtgacaacattccggaatggataaaaaca
acagaagtctactcagaatctaatgacaaatacattgactatatttactgtaatgacaag
gcgactttagcctatctcaataatctgggctgtatcgatctcaacccctggaacagctca
atcccagatcttgaacatcccgactatttagtgctggatcttgatccttctaaaaagaat
acatttgacgatgttattgaaaccgccttgcaagtgaacgaagtattgctttcaattaag
gtgaaggggtactgcaaaacttctgggagcacaggaattcatatttatatccccatgggt
gctaaatacgaatttgaccaggtaaaggatttcgcccatattgtgatgaaacaggtcaat
gaaaaactgcccaaaataacaactttagaaagaagcttacagaaaagagatgataagaaa
atttatctcgattaccttcaaaacaggacaggacagacattggcaagtgcatacagctta
cgtccaaaacaaggagcttctgtttcgatgcctttggactggaacgatgtaaaaccagga
ttgaaacctactgatttcaatatccataactcgttggaaagaattaaagaaaatggagat
ttatttaaacctgttttgggaaaaggaattgatatgatgaaggcattggaactcctacaa
aatttaaaataa

DBGET integrated database retrieval system