Capra hircus (goat): 100861254 Help Entry 100861254         CDS       T02910                                  Symbol BCL2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism chx  Capra hircus (goat) Pathway chx01521   EGFR tyrosine kinase inhibitor resistance chx01522   Endocrine resistance chx01524   Platinum drug resistance chx04064   NF-kappa B signaling pathway chx04066   HIF-1 signaling pathway chx04071   Sphingolipid signaling pathway chx04115   p53 signaling pathway chx04140   Autophagy - animal chx04141   Protein processing in endoplasmic reticulum chx04151   PI3K-Akt signaling pathway chx04210   Apoptosis chx04215   Apoptosis - multiple species chx04217   Necroptosis chx04261   Adrenergic signaling in cardiomyocytes chx04340   Hedgehog signaling pathway chx04510   Focal adhesion chx04621   NOD-like receptor signaling pathway chx04630   JAK-STAT signaling pathway chx04722   Neurotrophin signaling pathway chx04725   Cholinergic synapse chx04915   Estrogen signaling pathway chx04928   Parathyroid hormone synthesis, secretion and action chx04933   AGE-RAGE signaling pathway in diabetic complications chx05014   Amyotrophic lateral sclerosis chx05022   Pathways of neurodegeneration - multiple diseases chx05132   Salmonella infection chx05145   Toxoplasmosis chx05152   Tuberculosis chx05161   Hepatitis B chx05162   Measles chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05200   Pathways in cancer chx05206   MicroRNAs in cancer chx05207   Chemical carcinogenesis - receptor activation chx05210   Colorectal cancer chx05215   Prostate cancer chx05222   Small cell lung cancer chx05226   Gastric cancer chx05417   Lipid and atherosclerosis chx05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100861254 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     100861254 (BCL2)    04630 JAK-STAT signaling pathway     100861254 (BCL2)    04064 NF-kappa B signaling pathway     100861254 (BCL2)    04066 HIF-1 signaling pathway     100861254 (BCL2)    04071 Sphingolipid signaling pathway     100861254 (BCL2)    04151 PI3K-Akt signaling pathway     100861254 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100861254 (BCL2)   09143 Cell growth and death    04210 Apoptosis     100861254 (BCL2)    04215 Apoptosis - multiple species     100861254 (BCL2)    04217 Necroptosis     100861254 (BCL2)    04115 p53 signaling pathway     100861254 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100861254 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100861254 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     100861254 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     100861254 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100861254 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     100861254 (BCL2)    04722 Neurotrophin signaling pathway     100861254 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100861254 (BCL2)    05206 MicroRNAs in cancer     100861254 (BCL2)    05207 Chemical carcinogenesis - receptor activation     100861254 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     100861254 (BCL2)    05226 Gastric cancer     100861254 (BCL2)    05215 Prostate cancer     100861254 (BCL2)    05222 Small cell lung cancer     100861254 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100861254 (BCL2)    05161 Hepatitis B     100861254 (BCL2)    05162 Measles     100861254 (BCL2)    05168 Herpes simplex virus 1 infection     100861254 (BCL2)    05169 Epstein-Barr virus infection     100861254 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     100861254 (BCL2)    05152 Tuberculosis     100861254 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100861254 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100861254 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     100861254 (BCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100861254 (BCL2)    05418 Fluid shear stress and atherosclerosis     100861254 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100861254 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100861254 (BCL2)    01524 Platinum drug resistance     100861254 (BCL2)    01522 Endocrine resistance     100861254 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:chx01009]     100861254 (BCL2) Protein phosphatases and associated proteins [BR:chx01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      100861254 (BCL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  100861254 NCBI-ProteinID:  NP_001301142 EnsemblRapid:  ENSCHIG00000016322 UniProt:  A0A076FZV9 LinkDB All DBs Position 24:complement(61577610..61770906) Genome browser AA seq 229 aa AA seqDB search MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGAAGAAPPGAAPAPGILSSQPGRTPAPS RTSPPPPPAAAAGPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRF ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHAWIQ DNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK NT seq 690 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgcggggggcacaggctacgataaccgcgagatcgtgatgaagtacatccac tacaagctgtcgcagcgcggctacgagtgggatgccggagccgcgggcgccgcgcccccc ggggccgctcccgcgccgggcatcctgtcctcccagccgggccgcacacccgcgccctcc aggacctccccgccgccgcccccggccgccgccgccgggcctgcgcccagcccggtgcca cctgtggtccacctgaccctgcgccaggccggcgatgacttctctcggcgctaccgccgc gacttcgccgagatgtccagccagctgcacctgacgcccttcaccgcgaggggacgcttc gccacggtggtggaggagctcttcagggacggggtgaactgggggcgcatcgtggccttc tttgagttcggaggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtg gacagcatcgccctgtggatgaccgagtacctgaaccggcacctgcacgcctggatccag gacaacggaggctgggacgcctttgtggagctgtacggccctagcatgcggcccctgttt gatttctcctggctgtctctgaaggcactgctcagtctggccctggtgggcgcttgcatc accctgggtgcctatctgggccataagtga

DBGET integrated database retrieval system