Capra hircus (goat): 102182694 Help Entry 102182694         CDS       T02910                                  Symbol CXCL14 Name (RefSeq) C-X-C motif chemokine 14   KO K10033   C-X-C motif chemokine 14 Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04061   Viral protein interaction with cytokine and cytokine receptor chx04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102182694 (CXCL14)    04061 Viral protein interaction with cytokine and cytokine receptor     102182694 (CXCL14)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102182694 (CXCL14)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     102182694 (CXCL14) Cytokines and neuropeptides [BR:chx04052]  Cytokines   Chemokines    102182694 (CXCL14) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF6355 NinB DUF4863 Motif Other DBs NCBI-GeneID:  102182694 NCBI-ProteinID:  XP_005683371 EnsemblRapid:  ENSCHIG00000008797 UniProt:  A0A452DY80 LinkDB All DBs Position 7:63440968..63449395 Genome browser AA seq 99 aa AA seqDB search MRLLTAALLLLLLALCAARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITT KSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaggctcctgaccgccgcgctgctcctgctgctcctggcgctgtgcgccgcgcgcgtg gacgggtccaaatgcaagtgctcccgaaagggacccaagattcgctacagcgacgtgaag aagctggaaatgaagccaaagtacccgcactgcgaggagaagatggttatcatcaccacc aagagcatgtccaggtaccggggtcaggagcactgcctgcaccccaagctgcagagcacc aagcggttcatcaaatggtacaatgcctggaatgagaagcgcagggtctacgaagaatag

DBGET integrated database retrieval system