KEGG   Carboxydothermus hydrogenoformans: CHY_1143Help
Entry
CHY_1143          CDS       T00287                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHY_1143 (pfkA)
   00030 Pentose phosphate pathway
    CHY_1143 (pfkA)
   00051 Fructose and mannose metabolism
    CHY_1143 (pfkA)
   00052 Galactose metabolism
    CHY_1143 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CHY_1143 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CHY_1143 (pfkA)
Enzymes [BR:chy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CHY_1143 (pfkA)
Protein phosphatases and associated proteins [BR:chy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CHY_1143 (pfkA)
Messenger RNA biogenesis [BR:chy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CHY_1143 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1017037..1018002
Genome map
AA seq 321 aa AA seqDB search
MNSIGVLTSGGDAPGMNAAVRAVVRKALFHGIKVYGIERGYAGLINNEIKEMSLGSVGDI
IQRGGTVLKTARSLEFKTYEGRLRAFQNLKNHGIEGLVVIGGDGSFQGALKLYEEFGVKV
VGIPATIDNDIYGTDYSIGFDTTVNTVVDAINKIRDTAFSHERTFIVEVMGRNAGFIALE
AGIAGGAESIIIPEIPYSIEEICQKLIKSHQRGKLHSIIIIAEGAGSGIKLGEVIKEKTG
FETRVTILGHIQRGGSPSAFDRILASRMGAMAVDALREGISQGVMVAFEKGEYVLKPLET
AFSGKKQIDLEYYRLADILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaactccattggggttttaaccagcggtggcgatgcgccaggaatgaacgcagcggtt
cgggcggtagttagaaaagccctttttcacgggataaaagtttacggaattgaacgaggt
tatgccggcttaattaataatgagataaaagaaatgagtttgggcagtgttggtgacatc
atccaaaggggcggaacggtcttaaaaactgcccgctctttagaatttaaaacttatgaa
ggcaggttaagagcttttcaaaatttaaaaaaccatggcatcgaaggtttggtggttatt
ggaggagatggctccttccagggagccttaaaactttatgaggaatttggggtaaaggtg
gtcggtatacccgcaactattgacaatgacatttatggtaccgattattcaattggtttt
gatacgacggtaaatacggtggtagatgctattaataaaatacgggatactgccttttcc
catgaacgtaccttcattgttgaggttatgggaagaaacgccgggtttatagctttagaa
gcaggaattgctggaggagctgaatcgataattatcccggaaataccttactctatcgag
gaaatttgccaaaagttaattaagagccatcagcggggaaaattacatagcataattatc
attgctgagggcgcgggaagcggcattaagctgggagaagtaattaaggaaaagaccggt
tttgagacccgggtaacgattttaggccacatccagcggggtggaagcccttcggctttt
gaccgaattttagcaagccggatgggtgctatggcggttgatgccttaagagaggggatt
tcccaaggggtgatggttgcctttgagaagggcgaatatgttttaaagcccctggaaact
gctttttcggggaaaaagcaaattgaccttgaatattatcgtttagccgatattttatcg
atttaa

DBGET integrated database retrieval system