KEGG   Carboxydothermus hydrogenoformans: CHY_1143Help
Entry
CHY_1143          CDS       T00287                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
chy00010  Glycolysis / Gluconeogenesis
chy00030  Pentose phosphate pathway
chy00051  Fructose and mannose metabolism
chy00052  Galactose metabolism
chy00680  Methane metabolism
chy01100  Metabolic pathways
chy01110  Biosynthesis of secondary metabolites
chy01120  Microbial metabolism in diverse environments
chy01130  Biosynthesis of antibiotics
chy01200  Carbon metabolism
chy01230  Biosynthesis of amino acids
chy03018  RNA degradation
Module
chy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHY_1143 (pfkA)
   00030 Pentose phosphate pathway
    CHY_1143 (pfkA)
   00051 Fructose and mannose metabolism
    CHY_1143 (pfkA)
   00052 Galactose metabolism
    CHY_1143 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CHY_1143 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CHY_1143 (pfkA)
Enzymes [BR:chy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CHY_1143 (pfkA)
Protein phosphatases and associated proteins [BR:chy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CHY_1143 (pfkA)
Messenger RNA biogenesis [BR:chy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CHY_1143 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABB13634
UniProt: Q3ACZ6
LinkDB All DBs
Position
1017037..1018002
Genome map
AA seq 321 aa AA seqDB search
MNSIGVLTSGGDAPGMNAAVRAVVRKALFHGIKVYGIERGYAGLINNEIKEMSLGSVGDI
IQRGGTVLKTARSLEFKTYEGRLRAFQNLKNHGIEGLVVIGGDGSFQGALKLYEEFGVKV
VGIPATIDNDIYGTDYSIGFDTTVNTVVDAINKIRDTAFSHERTFIVEVMGRNAGFIALE
AGIAGGAESIIIPEIPYSIEEICQKLIKSHQRGKLHSIIIIAEGAGSGIKLGEVIKEKTG
FETRVTILGHIQRGGSPSAFDRILASRMGAMAVDALREGISQGVMVAFEKGEYVLKPLET
AFSGKKQIDLEYYRLADILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaactccattggggttttaaccagcggtggcgatgcgccaggaatgaacgcagcggtt
cgggcggtagttagaaaagccctttttcacgggataaaagtttacggaattgaacgaggt
tatgccggcttaattaataatgagataaaagaaatgagtttgggcagtgttggtgacatc
atccaaaggggcggaacggtcttaaaaactgcccgctctttagaatttaaaacttatgaa
ggcaggttaagagcttttcaaaatttaaaaaaccatggcatcgaaggtttggtggttatt
ggaggagatggctccttccagggagccttaaaactttatgaggaatttggggtaaaggtg
gtcggtatacccgcaactattgacaatgacatttatggtaccgattattcaattggtttt
gatacgacggtaaatacggtggtagatgctattaataaaatacgggatactgccttttcc
catgaacgtaccttcattgttgaggttatgggaagaaacgccgggtttatagctttagaa
gcaggaattgctggaggagctgaatcgataattatcccggaaataccttactctatcgag
gaaatttgccaaaagttaattaagagccatcagcggggaaaattacatagcataattatc
attgctgagggcgcgggaagcggcattaagctgggagaagtaattaaggaaaagaccggt
tttgagacccgggtaacgattttaggccacatccagcggggtggaagcccttcggctttt
gaccgaattttagcaagccggatgggtgctatggcggttgatgccttaagagaggggatt
tcccaaggggtgatggttgcctttgagaagggcgaatatgttttaaagcccctggaaact
gctttttcggggaaaaagcaaattgaccttgaatattatcgtttagccgatattttatcg
atttaa

DBGET integrated database retrieval system