KEGG   Carboxydothermus hydrogenoformans: CHY_2327Help
Entry
CHY_2327          CDS       T00287                                 

Gene name
tuf2
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
chy  Carboxydothermus hydrogenoformans
Brite
Translation factors [BR:chy03012]
 Eukaryotic Type
  Elongation factors
   CHY_2327 (tuf2)
 Prokaryotic Type
   CHY_2327 (tuf2)
Mitochondrial biogenesis [BR:chy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CHY_2327 (tuf2)
Exosome [BR:chy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CHY_2327 (tuf2)
  Exosomal proteins of breast cancer cells
   CHY_2327 (tuf2)
  Exosomal proteins of colorectal cancer cells
   CHY_2327 (tuf2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2089329..2090531)
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERVKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGLAQQKRYDEIDNAPEERERG
ITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDPELMELVEMEVRDLLSTYEFPGDEVPVVAGSALKALE
CGCGKEDCPWCGKILELMDKVDEYIPTPQRDVDKPFLMPVEDVFTITGRGTVATGRVERG
RITIGEEVEIVGLMDAPRKTVVTGLEMFRKVLDEAVAGDNIGALLRGVDRKEIERGQVLA
KPGTIKPHRKFFAEVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGVIHLPEGVEMVMPG
DNVKIHIELITPIAIEEGLRFAIREGGRTVGAGVVTAIEE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcgaaatttgagcgggtaaaaccgcacgtaaacattgggacgataggtcac
gtagaccacgggaagaccaccttgaccgcagcaattactacggtgctggcgaagaaggga
ttagcccagcaaaagaggtacgatgagattgacaatgctccggaagaaagggaaagagga
attaccattaatacagcgcatgtggagtatgagaccgagaagcggcactatgcccacgta
gactgtccgggacacgctgactacgtaaagaacatgataactggagcggcgcagatggac
ggagctatcctggttgtgtctgcagccgatggtccgatgccgcagacgcgggagcacatt
ttgttagcccgtcaggtaggagttccctatattgtagtatttttaaacaaagcggacatg
gtagatgatccggagttaatggagcttgtagagatggaagtgcgggatcttttaagcacg
tacgagtttccgggggatgaagtaccggtagtagcggggtcggcattgaaggcattggag
tgcggttgcgggaaagaagattgtccgtggtgtgggaagatattggagttaatggacaag
gtagacgaatacattccgacaccgcagcgggatgtagataagccgttcttaatgccggta
gaggacgtatttaccattaccggacgtgggacggttgcgaccggccgggtagagcgggga
cggataaccataggagaagaagtggagatagtaggattgatggatgctccgcggaagacg
gtagtaacgggactggagatgttccggaaggtattagacgaagcggtagcaggggacaac
ataggagcgttattacggggagtagaccggaaggaaatcgagcgggggcaggtattggcg
aagcctggtacgataaagccgcaccggaagttttttgcggaggtatacgtattgacgaag
gaagaagggggacggcacacaccgttctttaatggataccggccgcagttttacttccgg
acgacggacgtaacgggagtaatccatttaccagaaggtgtagagatggtaatgcccggg
gataacgtaaagattcatattgagcttatcacaccgattgctattgaagaaggattgaga
tttgctattcgggaaggtggcagaactgtaggcgcgggcgttgttaccgcgatcgaagag
taa

DBGET integrated database retrieval system