KEGG   Chryseobacterium sp. StRB126: CHSO_1823Help
Entry
CHSO_1823         CDS       T03602                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
chz  Chryseobacterium sp. StRB126
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:chz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CHSO_1823
  Energy metabolism
   00680 Methane metabolism
    CHSO_1823
Enzymes [BR:chz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CHSO_1823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2113275..2115809
Genome map
AA seq 844 aa AA seqDB search
MRHDQRAEKFRQIVENKFQIYNSLFMSLPYDKMTNIGMLLPFLYEESRIGYEGGKTPEEI
VEEFFKNHTDLQTEEQKLELLFKIIQYIERQVVLFDSIEDAAFPNLHSESDGGTVTNLFE
RSFQDHKIEKVREKLKDFSVKVVFTAHPTQFYPSSVQRIIQDLRGAITSDSVTQIDTLLQ
QLGKTPFVNKEKPTPIDEALSIISYLRYVYYDTIGELFTKIKKTFGNGHFHLHEDLIQLG
FWPGGDRDGNPFVTADVTKRVAEELRSAILKSYYSHLKFIRRRLSFRGVSEVLTVLSEEL
YAAIFDGKTITAEDMLKRTDEAEKILVNEHNALFLDLLVNFRDRVKIFGTHFATLDIRQD
SRIHQKVIDEVFVKVYGNEEVDYEEKFNKLIQVSGPVNANDFEDIVKDTLLTVSQVSEIQ
NLNGLRGMNRYIISNSDAVKDVMNVYAFFKICGYKNEDINMDIVPLFETMEGLDNAEHVM
NELYQNPVYKKHLERRGNQQTIMLGFSDGTKDGGYLKANWEIYKAKEVLTKLSEQNNIKV
VFFDGRGGPPARGGGKTHDFYASQGKTIANNKIELTIQGQTITSIFGNKEQAMYNFEQLL
TAGVENDVFKNAKKDLTEKERALIIELANISYQKYSDLKAHPMFVPYLQEMSTLEYYGKT
NIGSRPSKRGNGNELKFEDLRAIPFVGSWSQLKQNVPGFFGFGYAMQQMKEQGRFEEVRE
LYKGSDFFKTLVLNSMMSMNKSYFPLTYYIKKNPKFGAFWNILFSEYELSRDIMLELTGF
KMLQEEDPLSRKSVKIREKIVLPLLSIQQYALMKIQKGEGNKEAYEKLVTRSLFGNINAS
RNSA
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgagacacgaccaacgcgcagaaaaattcaggcagatcgtggagaacaaattccagatc
tacaattcattatttatgagcctgccctatgataaaatgactaatattgggatgctgctt
ccttttctttatgaggaaagcagaatcggatacgaaggcggcaaaacacccgaagaaatt
gttgaagaattctttaaaaaccataccgatctacagaccgaagagcagaaacttgaactg
ctttttaagattatccagtatatagaaagacaggtggttttatttgatagtatcgaagat
gcagcgtttccgaacctgcattctgaaagtgatggtggaaccgttactaatctctttgaa
cgttctttccaggatcataaaattgaaaaagtacgggaaaagctaaaggatttcagtgtg
aaggtagtgtttaccgcacaccccactcagttttatccaagttcagtacagagaatcatc
caggatcttagaggagccattaccagtgattccgttactcagattgatacccttttacag
caattaggaaaaacgccttttgtgaacaaagaaaaaccaacccctattgatgaggcgttg
agcattatttcctacctgagatatgtatattacgatacgatcggtgagttatttaccaag
attaaaaaaacttttggaaacggacactttcatctgcatgaagatcttattcaacttggc
ttctggccgggcggggaccgcgacggaaacccttttgtgacggcagatgttaccaaaaga
gtagcggaagaacttcgttcagccattctgaaatcttattacagtcacttgaaattcatc
agaagaagattaagcttcagaggcgtttcagaagtattgacagtgttgagtgaggaattg
tatgccgctatttttgatggtaaaaccattactgcagaagatatgttaaagagaaccgat
gaggctgaaaaaatattagtgaatgagcacaatgccctgtttttagatcttttggttaat
ttcagggatcgtgtgaagattttcggaactcattttgcgacattggatatccgccaggac
agcagaattcaccaaaaagtaattgatgaggtttttgtaaaagtatatggcaatgaagaa
gtggattatgaagagaaattcaataaactgattcaggtttcaggtcctgtaaatgcaaat
gattttgaagatattgtaaaggatactttattaactgtatctcaggtctctgaaattcag
aatttgaacggactgagaggaatgaaccgttatattatctccaattctgatgcggtgaaa
gatgtaatgaatgtttatgctttctttaagatttgcggatataagaatgaagatatcaac
atggatattgtaccgctttttgaaaccatggaagggcttgataatgctgaacatgtgatg
aatgagttataccagaaccctgtttataaaaaacatcttgaaagaagagggaaccagcag
accattatgttgggattttctgatggaaccaaggatggtggttatttaaaagccaactgg
gaaatttataaggctaaagaagtcctgacaaaactttcagaacagaataatatcaaagtt
gtatttttcgacggtagaggcggacctccggcaagaggtggcgggaaaacccatgatttc
tatgcttctcagggaaaaacaattgctaacaataaaattgaactaacgatccaagggcag
acgattaccagtatttttggaaataaggagcaggcaatgtataattttgaacaacttttg
actgccggagtagaaaatgatgtattcaaaaatgctaaaaaagaccttacggaaaaagaa
agagctttgattattgaactggcgaatatcagttatcagaaatactcggatctgaaggcg
catccaatgtttgtgccttatctgcaggagatgagtaccctggaatactatgggaaaacc
aatatcggaagccgtccgtccaaaagaggaaacggaaatgaactgaagtttgaagatctg
agagcgatcccttttgtaggttcctggtcacaattgaagcagaacgttcccggatttttt
gggtttggctacgctatgcagcagatgaaggagcagggaagatttgaagaagtaagagaa
ttgtataaaggatcagatttctttaaaacattggtcttgaactccatgatgagtatgaac
aagtcttatttcccgttgacttactacattaaaaagaaccctaaatttggagccttctgg
aatattcttttcagtgaatatgaactttcaagagatatcatgctggaacttaccgggttc
aaaatgcttcaggaagaagatccgttatccagaaaatctgtgaaaatccgtgagaagatt
gttctaccattgctaagtattcagcaatatgcactgatgaaaatccaaaaaggagaagga
aataaagaagcctatgaaaaattagtgacaagatcattgtttggaaatattaatgcaagc
cgaaattctgcttaa

DBGET integrated database retrieval system