KEGG   Chryseobacterium sp. StRB126: CHSO_3291Help
Entry
CHSO_3291         CDS       T03602                                 

Gene name
mro
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
chz  Chryseobacterium sp. StRB126
Pathway
chz00010  Glycolysis / Gluconeogenesis
chz00052  Galactose metabolism
chz01100  Metabolic pathways
chz01110  Biosynthesis of secondary metabolites
chz01120  Microbial metabolism in diverse environments
chz01130  Biosynthesis of antibiotics
Module
chz_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:chz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHSO_3291 (mro)
   00052 Galactose metabolism
    CHSO_3291 (mro)
Enzymes [BR:chz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     CHSO_3291 (mro)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAP32328
UniProt: A0A077KMI8
LinkDB All DBs
Position
complement(3723444..3724601)
Genome map
AA seq 385 aa AA seqDB search
MKKTTHNGIFILLFLIIFGCKKENNKQDISGKMENISTSDYGVTPKDDSIKKYTLTNKNG
MKVEVINFGGIITSLTVPDKNGKYEDVVLGFTKPEGYFDGNPYYFGALIGRYGNRIANAK
FTLEGKTYEIDKNDGPNSLHGGKEGFHTRFWNIEAVKDAKFPTLKLSYTSADGEEGYPGK
LTTTVFYTLTDDNALEISYEAETDKPTVVNLTQHSYFNLSGNFTKTITDHEMQINADKFL
PVNETLIPTGEQKAVKGTPFDFTVSKPIGKDINADDDQLKKGKGYDHNWILNGKGLRSIA
KVYHLETGRLMEVFTDEPGVQFYSGNFLDGKFDTKTGGKNEFRTGFCLETQHFPDSPNQP
SFPSTELKAGQKYQSKTIYKFSVKN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaacacataatggcatttttattttattatttttaattattttcggctgt
aaaaaagaaaataataaacaggatatttcaggaaaaatggagaacatttctacttcagac
tatggagttacgccaaaagacgattctattaaaaaatatactttgaccaataaaaacggg
atgaaagttgaggtcatcaacttcggtgggattatcacttctttaaccgtacctgataag
aatgggaaatacgaagatgtagtgcttggctttacaaaaccagaaggatattttgatggc
aacccttattatttcggggctttgatcggaagatacggcaacaggattgccaatgcaaag
tttacactggaagggaaaacttacgaaattgataaaaatgacggtcccaatagtcttcac
ggaggaaaagaaggatttcataccagattctggaatattgaggccgtaaaagatgcgaaa
tttccgacattgaaattatcttataccagtgcagatggtgaagaaggatatccgggaaaa
ttaacaacaaccgttttctacacgcttacagacgataatgctttggaaatttcctatgaa
gcagaaaccgataagcctacagtggtgaatcttacccagcattcttattttaacctgtcc
ggaaattttactaaaacgattaccgatcatgaaatgcagattaatgcagataagttttta
cctgtgaatgaaactctgattcctaccggtgagcagaaagcggtaaaaggaactcccttt
gatttcacggtttcaaaacccatcggaaaagatatcaatgcagacgatgatcagctgaaa
aaaggaaaaggatatgatcacaactggattctgaatggtaagggtctcagaagcatagcc
aaagtctatcatctggaaacaggaagactgatggaagtctttacagatgaacctggtgta
cagttttattccggtaattttcttgacggaaagtttgataccaaaacaggaggtaaaaat
gaattcagaacaggattctgcctggaaacccagcatttcccggattcaccgaaccagcct
tctttcccttccacagaattgaaggcagggcagaaataccagtcgaaaaccatctataaa
ttctccgttaaaaactaa

DBGET integrated database retrieval system