KEGG   Citrus clementina (mandarin orange): CICLE_v10009532mgHelp
Entry
CICLE_v10009532mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CICLE_v10009532mg
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CICLE_v10009532mg
Enzymes [BR:cic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CICLE_v10009532mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 201 aa AA seqDB search
MISPKTFLKESYRAESRKGGDETKACPKKMSASIFTAPVAGSGYLGLKPTSKALLPVKDS
IAWSSKTVSNGSKTRCMKTWNPINNKKFEALSYLPSLSDDSIAKEIDYMLKKGWIPCLEF
DEVGYVHRENSRMPGYYDGRYWTMWKLPMFGCNDSSQILNEIQECKKAYPNAYIRCLAFN
NQKQGQCMSFLIQKPTTTTST
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatctcacctaaaacttttctcaaagaaagttatcgagcggagagtagaaagggtggt
gatgaaaccaaagcttgcccgaagaagatgtctgcaagcatctttacagctccagttgct
ggttctggctatcttggcctaaaacccacatcgaaagctttgcttccagttaaggattcc
attgcatggagcagcaaaacagtctcaaacggttcaaaaactcgatgcatgaagacatgg
aatccaatcaataacaaaaagtttgaggccctctcctacctgccatcgctctcggatgat
tcaattgcaaaggagattgactacatgctcaaaaagggatggatcccttgccttgaattt
gatgaggtgggatatgtgcacagggagaatagcagaatgccagggtattatgatgggagg
tattggacaatgtggaagttgccaatgtttggatgcaatgattcatctcaaatcctgaat
gaaatacaagagtgcaaaaaagcatacccaaatgcttatattcgctgcttggcatttaac
aatcagaaacagggtcagtgcatgtcctttctcatccagaaacctaccaccaccactagc
acctaa

DBGET integrated database retrieval system