KEGG   Celeribacter indicus: P73_3200Help
Entry
P73_3200          CDS       T03575                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cid  Celeribacter indicus
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cid00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    P73_3200 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    P73_3200 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    P73_3200 (ddl)
Enzymes [BR:cid01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     P73_3200 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:cid01011]
 Precursor biosynthesis
  Amino acid ligase
   P73_3200 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3265871..3266746)
Genome map
AA seq 291 aa AA seqDB search
MGGPSAEREVSLSSGRECAAALRGEGFEVIEIDAGADLCAHLRDAAPDVVFNALHGRYGE
DGCVQGLLEWLRIPYTHSGVLASALAMDKEKTKEVYRAAGLPVVESRLARREEVEAGHVL
APPYVVKPYNEGSSVGVYIVREGSNAPRLSAEMPAVVMVEAYAPGRELTCTVMGDRAFCV
TDILTDGWYDYDAKYKAGGSRHVCPAEIPDEIAAACRDYALRAHAALGCRGVSRTDFRWD
EGRGLDGLILLETNTQPGMTPTSLSPEQARAEGITFGRFVAWMVEDASCDR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgggcggaccttcggccgagcgcgaagtgtccctgtcctccgggcgtgaatgcgccgcc
gcactgaggggcgaaggattcgaggtcatcgagatcgacgcgggcgcggacctgtgcgca
catctgcgcgacgccgcacccgatgtcgtgttcaatgcgctgcacgggcggtacggcgag
gacggctgcgtccagggcctgctcgaatggctgcgcattccatacacccattcgggcgtt
ctcgcctctgccctggcgatggacaaggagaagaccaaggaggtctatcgcgccgccggc
cttcctgtcgtcgagagccgcctggcccggcgcgaggaggtcgaggccgggcatgtgctc
gcgccgccctatgtggtcaaaccctataacgaaggctcctccgtcggcgtctatatcgtg
cgcgagggcagcaatgcgccgcgcctctctgcggagatgccggcggtcgtcatggtcgag
gcctatgcgccgggccgggagctgacctgcaccgtcatgggcgaccgcgcgttctgcgtg
accgacatcctgacggacggctggtacgattacgacgcgaaatacaaggcaggcggctcg
cgccatgtctgtcccgccgagatccccgacgagattgccgcggcctgccgcgactacgcc
ctgcgtgcccatgcggcgctcggctgccggggcgtctcgcgcacggatttccgctgggac
gagggcagggggctcgacgggctcatcctgctcgagaccaacacccagccgggcatgacc
cccacatcgctctcgccggaacaggcgcgggcggaggggatcacgttcggccggttcgtg
gcctggatggtggaggatgcctcatgcgaccggtag

DBGET integrated database retrieval system