KEGG   Citrobacter sp. FDAARGOS_156: AL515_06575Help
Entry
AL515_06575       CDS       T04313                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cif00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AL515_06575
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AL515_06575
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AL515_06575
Enzymes [BR:cif01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AL515_06575
Peptidoglycan biosynthesis and degradation proteins [BR:cif01011]
 Precursor biosynthesis
  Amino acid ligase
   AL515_06575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1420392..1421486)
Genome map
AA seq 364 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKQGQWHVSDASNYLLN
SNDPAHIALRPSATSLAQVPGKQEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNIAPFITLTRANRNSIGFAEVESRLGL
PLFVKPANQGSSVGVSKVTSEAQYNQAIALAFEFDHKVVVEQGIKGREIECAVLGNDHPQ
ASTCGEIVLNSDFYAYDTKYIDDNGAKVVVPAAIAPEINDKIREIAIQAYQTLGCAGMAR
VDVFLTAENDVVINEINTLPGFTNISMYPKLWQASGLSYTDLITRLIELALERHAADSAL
KTSM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttgcgggtaggaatcgtatttggtggtaaatcagcggaacatgaagtgtca
ttgcaatcggcaaaaaatattgtcgatgccatcgacaagactcgctttgacgttgtgctg
ttaggtattgataaacaagggcagtggcacgtgagcgatgccagtaactatctgctcaat
tcaaacgatccggcacatattgcactgcgtccctccgcgaccagtctggcgcaggtgccg
ggtaaacaagaacatcagttaatcgatgcgcaaaatggtcagccgctgccaacggtcgat
gttattttcccaattgtgcacggcacgctgggtgaagatggttcactgcaaggcatgctg
cgcgtggcgaatctgccgttcgtcggttcagatgtgctgggctctgcagcctgcatggat
aaagacgtcaccaaacgtctgctgcgcgatgccggattaaacatcgcgccatttattacg
ctaactcgcgccaatcgcaacagcatcggctttgccgaggtcgagtcccgcctgggcctg
ccgctgtttgtgaaaccggccaaccaggggtcgtccgttggcgtcagtaaagtgaccagt
gaagcacagtacaaccaggccatcgcactggcatttgaattcgatcataaagttgtggtc
gagcaagggatcaaaggtcgcgaaatagaatgcgcggtgctgggcaacgatcatccgcag
gccagtacctgtggcgagatcgtgctgaacagtgatttttacgcgtacgataccaaatat
attgacgataacggggccaaagtcgtggttccggcggcgattgccccagaaattaacgac
aagatccgtgagatcgctattcaggcttaccagacgctgggttgcgccgggatggcgcgg
gtggatgtgttcctgaccgcagagaatgacgtggtgatcaacgagatcaacacgctgccg
ggctttaccaacatcagtatgtatcccaaactgtggcaggccagcggcttaagctatacc
gatctgatcacacgtctgatcgagctggcgctggagcgccacgctgccgatagcgcgctg
aaaaccagcatgtaa

DBGET integrated database retrieval system