KEGG   Chryseobacterium sp. IHB B 17019: ATE47_01435Help
Entry
ATE47_01435       CDS       T04193                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cih  Chryseobacterium sp. IHB B 17019
Pathway
cih03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cih00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    ATE47_01435
Enzymes [BR:cih01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ATE47_01435
DNA repair and recombination proteins [BR:cih03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ATE47_01435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ALR29274
UniProt: A0A0S3FNK5
LinkDB All DBs
Position
314108..316810
Genome map
AA seq 900 aa AA seqDB search
MGLSKYREKRSQEKTPEPFGGEPSGKELRFVVQKHDASHLHYDFRLEMDGVLKSWAVPKG
PSLDPEIKRLAMMVEDHPYDYRDFEGIIPKGQYGGGTVIVWDEGTYEPAEPVDGDLKKQE
KHLLHQLYSGKIKILMKGKKLKGEFALVKAHGRGENGWLLMKLDDKYASKDDVTLKDKSV
ISRKTIEQMEKAPDNVYGRNIMKKNTTVKDKKATARKAVEVIDSQLAAEPETQVAKQPKL
TNLLKGTTKEKFYDSVQPMLATLVDEPFDSNDWLYEIKWDGYRAVAFMEGKKIELKSRND
KSFAEKFYPIYDELTNLKLDAVLDGEIVVLGEHGKANFGSLQNWRSEADGDLVYYVFDIL
WYKGMDLKGLTLVERKAILAQVLPESKTILLSKEFDTSGLEFLEAATKMGLEGIMAKRKG
SIYHTHNRTKDWLKIKANKRQEVVIGGFTRNDDTNKQFSSLLVGVYEGKKLIYTGKVGTG
FNDKMQKEMMEQFKPLFTDKPPFSEEPDVNKPSRFRPNPPHATVTWLKPELIGEVSYTEL
TSDGVMRHPSFKGMRSDKSAKKVVLERERNTEDVLSDEKDTIVNPRGKQGRKTLLNPTEK
TQVKKINRHELKFTNLDKIFWPDEKITKRDLINYYYQIAPYILPYLKDRPQSMNRFPDGI
KGGGFYFKDVTGKAPDWIERYSYTSDSDHRERQYLVGSDEATLLYMANLACIEMNPWNST
IKKTDHPTYCIIDLDPDKNSFDQVIETALVAKQILDDMGVPSYCKTSGSTGLHIYIPLGN
KYTYEQSKEFARVIVTLIHRELPKFTTIERAISDRKGKMYLDFLQNRPHATIASVYSLRP
KPGATVSMPLQWDEVKQGLKMKDFNIFNAMERLESLGDIFKPVLGKGINMEKIISDASNG
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgggcttatctaaatatcgtgagaaacgatcacaagaaaagacgcctgaaccttttgga
ggcgaaccctcaggaaaagagttacgatttgtagtacaaaagcacgacgcctcgcacctg
cattacgatttcaggcttgagatggatggagtgctgaaaagctgggcagtccccaaggga
ccatcgttagatcctgagatcaaacggctggctatgatggttgaagaccatccctatgat
tacagggattttgagggaattattcctaaagggcaatatggtggtggtacagttatcgta
tgggatgaaggaacctacgaacccgcggagcccgtggatggcgatttgaaaaaacaggag
aaacacctgttgcatcagttgtattcgggtaagataaagatactgatgaaaggtaaaaag
ctcaaaggcgagtttgccctggttaaggcacatgggcggggagagaatggatggctgtta
atgaaactcgatgataaatatgccagtaaagatgatgtcaccctaaaagataaatctgta
atatccagaaaaaccattgaacagatggaaaaagcacccgacaatgtttatggccgtaat
atcatgaaaaaaaataccactgttaaggataaaaaggcaactgccagaaaagctgttgag
gtaattgattcacaactggcagcggagccggaaactcaagtagcgaaacagccaaaatta
acaaaccttctgaaaggaacaaccaaggagaaattttatgacagtgtgcagcctatgttg
gcaacgcttgttgatgagccatttgacagtaatgattggctttatgaaataaaatgggat
ggatatcgtgcagttgcctttatggaagggaaaaaaatagaactgaaatcccgcaacgat
aaaagttttgccgaaaaattttaccctatatatgatgagctgacaaacctgaaactggac
gctgtactcgacggggaaattgttgttcttggggaacatggcaaagcaaacttcggctcg
cttcagaactggcgtagtgaagcagatggcgatctggtgtactatgttttcgatattttg
tggtataagggaatggatctgaaaggacttactttggtagagagaaaagccattctcgca
caggtgctgccggaaagcaagactattctcctcagcaaggaatttgatacctctgggtta
gaatttttagaagcggcaacaaagatgggccttgagggtattatggcgaaacgtaaaggc
agtatatatcacactcacaatcgcaccaaagactggctcaaaattaaggcgaataaacgg
caggaggttgttattggcggttttacccgtaatgatgacaccaataaacagttcagcagt
ctacttgtcggggtctacgaaggtaaaaagttgatttacacaggaaaagtgggaacgggt
ttcaacgataagatgcagaaagaaatgatggaacagttcaaaccgctgttcacggataaa
ccacctttttccgaagagcctgatgtaaataaaccatcgcgcttccgtcccaatccaccg
catgcgactgtaacttggcttaaaccggaactgatcggtgaggtgagctacacggaactc
accagcgacggggtcatgcggcatccttcattcaaaggcatgcggtcagataaaagtgca
aaaaaggtagtgcttgaacgagaaaggaacacagaagacgttttatcggatgaaaaagat
accattgtgaatccgcgaggtaagcaagggaggaaaacgcttttaaatccaacagaaaaa
acgcaggtaaaaaaaataaacaggcacgaactgaaatttaccaacctcgataaaattttc
tggccggatgaaaaaattacaaagcgggacctgatcaattattattatcagattgcaccg
tatattttaccttacctgaaagaccgcccgcagagcatgaaccggtttcctgacggtatt
aaaggcggggggttctacttcaaggatgtgaccggaaaggcaccagactggattgaaaga
tatagttacaccagcgattctgatcatcgcgaaaggcagtatcttgtgggaagtgatgaa
gctacgttactttatatggctaacctcgcctgtattgagatgaatccgtggaatagcaca
attaaaaaaaccgatcatccgacctactgtattattgatcttgatccagataaaaattct
tttgaccaggtaattgaaacagcactagttgccaagcagattcttgatgatatgggtgtg
ccgagttactgtaagaccagcggatcaacggggcttcacatttatataccgcttggcaat
aaatacacctatgagcaaagcaaggaatttgcaagggtgatcgtgacgctaatacatcgc
gaacttccgaagtttacaacaatcgaaagggctatttctgaccgcaaaggaaagatgtac
cttgatttccttcagaaccgcccacatgcgaccattgcctcagtatactcattaagacca
aagcctggagcaactgtttcaatgcctttgcaatgggacgaggtaaaacaaggcttaaaa
atgaaagattttaatattttcaatgcgatggaaaggcttgaaagtttgggcgatattttt
aagcctgttctgggaaaagggattaacatggaaaagattatatcggatgcatcaaatggt
taa

DBGET integrated database retrieval system