KEGG   Chryseobacterium sp. IHB B 17019: ATE47_07340Help
Entry
ATE47_07340       CDS       T04193                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cih  Chryseobacterium sp. IHB B 17019
Pathway
cih03030  DNA replication
cih03410  Base excision repair
cih03420  Nucleotide excision repair
cih03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cih00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ATE47_07340
   03410 Base excision repair
    ATE47_07340
   03420 Nucleotide excision repair
    ATE47_07340
   03430 Mismatch repair
    ATE47_07340
Enzymes [BR:cih01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ATE47_07340
    6.5.1.6  DNA ligase (ATP or NAD+)
     ATE47_07340
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     ATE47_07340
DNA replication proteins [BR:cih03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    ATE47_07340
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     ATE47_07340
DNA repair and recombination proteins [BR:cih03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     ATE47_07340
   NER (nucleotide excision repair)
    Other NER factors
     ATE47_07340
   MMR (mismatch exicision repair)
    Other MMR factors
     ATE47_07340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme LysM
Motif
Other DBs
NCBI-ProteinID: ALR30347
UniProt: A0A0S3FRD4
LinkDB All DBs
Position
complement(1606624..1608204)
Genome map
AA seq 526 aa AA seqDB search
MKHFAELINALESTNKTNAKIDAIIDYLERAPDEDKVWFIALFTGKRPKRNVNTNYMKEW
ALEITGLPFWLFQESYSSVGDLGETLSLILPPPAKKIERSLSQWMNDIIDLKNKIDIEKK
EFVLNSWNGLDYTERLIFNKLLGGSFRIGVSDKTLINALTKFSEQESSTLMHSLMGKWQP
DEISFKELISAEKINPDNSKPYPFCLAYPLEKELKELGAPNDWLIEYKWDGIRGQIIRRN
DEVFIWSRGEELITEQFPEIKDVIQKMNGNFVIDGEILAVKDDKVLNFNELQKRLNRKTL
TKKMLSEIPIQVFAYDLLELENNDLREKPIAARRAMLEELLLNETPENIKISKVIEFERW
EDLNQIRENSREINSEGLMLKQKNSPYHSGRKKGDWWKWKINPLTIDAVLIYAQKGSGRR
SAYYTDYTFAVKNGDALVTIAKAYSGLTDKEIMEVSKFVNKNAIEKFGPVRTVKAELVFE
IAFEGIGFSNRHKSGVALRFPRIMRWRKDKTVDEIDDLEEIKKLIQ
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttgcagaacttatcaatgccttggaaagcacgaataaaaccaacgctaaa
attgacgccattatcgattatctggaacgtgcgcctgatgaagataaagtatggtttatt
gccctttttacggggaaaaggccaaaacgaaatgtgaataccaactacatgaaagaatgg
gcattggagattaccgggctgcctttttggctgtttcaggaaagctactcttcggtagga
gatctgggtgaaacactttcgttgattttacctcctccggcgaaaaaaattgagcgctca
ctttcccagtggatgaatgatattattgatcttaaaaataaaatcgacattgagaaaaaa
gaatttgttttaaattcatggaatggtttagattatacggaacgattgattttcaataaa
ttattaggaggaagtttcagaattggagtttctgataaaaccttaattaatgcattaaca
aaattctcagaacaggaatcaagcactttaatgcatagtttaatggggaaatggcagcct
gatgaaatttcatttaaagagttgatttcggcggaaaaaattaaccctgacaattcaaag
ccttatcctttctgcctggcgtacccgttagaaaaagaattgaaagaacttggagctccg
aatgactggttgattgaatacaaatgggacggaattcgtggacaaattatcagaagaaat
gatgaagtttttatctggtcgagaggtgaagagctgatcactgaacagtttcctgagata
aaagatgttattcaaaaaatgaatggaaatttcgtaatagatggagaaatacttgcggta
aaggatgataaggtattaaactttaacgaattacaaaaaagattaaatagaaaaacttta
actaaaaaaatgctttcggaaatcccgattcaggtttttgcgtatgatttactggaatta
gaaaataatgacttaagagaaaagccaattgcggcaagacgggcaatgctggaagaatta
ttattaaatgaaacccctgaaaacataaaaatttctaaagtaattgagtttgaaaggtgg
gaagatttaaaccaaatcagggaaaactcaagagaaattaacagtgaaggtttaatgcta
aaacaaaaaaattctccataccattccggacgtaaaaaaggtgattggtggaagtggaaa
atcaatcctttaactatcgatgccgttctgatttatgcccaaaaaggcagtggacggaga
agtgcctactacaccgattacacttttgccgttaaaaatggtgatgctttggtaactatt
gcaaaggcttattccggtttgacagacaaagaaataatggaagtaagcaagtttgttaat
aaaaatgctattgaaaaattcggacctgtccgaactgtaaaagctgagttggtttttgaa
attgcttttgaaggaataggtttcagtaatcgtcataaaagcggtgtagcactacgtttt
ccaagaattatgagatggcgtaaagacaaaacagtggatgaaattgatgatctggaggaa
ataaaaaaactaatacaataa

DBGET integrated database retrieval system