KEGG   Coccidioides immitis: CIMG_03802Help
Entry
CIMG_03802        CDS       T01114                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cim  Coccidioides immitis
Pathway
cim00250  Alanine, aspartate and glutamate metabolism
cim00410  beta-Alanine metabolism
cim00430  Taurine and hypotaurine metabolism
cim00650  Butanoate metabolism
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
Module
cim_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CIMG_03802
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CIMG_03802
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CIMG_03802
   00430 Taurine and hypotaurine metabolism
    CIMG_03802
Enzymes [BR:cim01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CIMG_03802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 4562870
NCBI-ProteinID: XP_001244361
UniProt: J3KC49
LinkDB All DBs
AA seq 554 aa AA seqDB search
MERADEVRNLLNPVQERILQFIQSADRGSKAIIAHDPSDESDPLFSGLLNLKRPSELQQE
LQVDFPGSGQGADGLLQILDRILQYSVNTWHQGFLDKLYASTNAPGLAAELIIAALNTNV
HVYQVAPALTVIEKSTAARLASLFGLNGPYAGGIAVQGGTASNTTAIVIARNTLFPETKT
EGVSGNQFVLFSSAHGHYSIEKAAQMLGFGSKAVWVVPVDEKGQMIPKALDDLIITAKSQ
GKKPFFVNATAGTTVVGSFDPLPEISEICRKHNLWFHVDGSWGGSFIFSSKQKSKLTGSH
LADSITFNPHKMLGVPVTCSFLLAADIRKFHRANTLPAGYLFHNEEYTKGFWDLGDLTLQ
CGRRADALKLFLSWMYYGSEGYEQKIDSACSVAEHLSTVVGNNPHLILLTENPPPCLQVC
FYYAPLGRMAYPPGREINGKTLSEEERAELNSQITEEIVQKLVPQGFMVDYAPPSDGDTF
AKDGKFFRCVVNVLTKEETVDSLVNTIVKLGSTIVKRRLGSELNIPTPTAHPAPTSGFRP
KNPAERGHGPVVFE
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggaacgggcggacgaagtcagaaatcttcttaaccccgtgcaggaacgcattctgcag
ttcatacagtctgcagatagaggttccaaagcaatcatagcgcatgacccttcggacgaa
agtgaccctctcttctccgggttattaaacttgaaaaggcccagtgagctccagcaggaa
ctccaggtagatttcccgggtagcgggcagggtgcggatggcctccttcagatcttagac
aggatacttcaatattctgtgaacacttggcatcagggatttttggacaaactctatgcc
tctacgaatgcgcccggacttgccgcggagttgatcattgcagccttgaacaccaatgtt
catgtgtaccaggtcgctccggccttgaccgttatcgagaagagtactgctgcccgtttg
gcctccctttttggcctaaatggcccgtacgctggagggatagcagtacaaggtggtaca
gcatccaatacaacggcaattgttatcgcgaggaatactctattcccggagaccaaaact
gaaggcgttagcggcaatcagtttgtcttgttctcaagtgcgcatggacattatagtatt
gagaaggctgcacaaatgcttggattcggtagcaaagcggtttgggtcgttcccgtggac
gagaaagggcagatgataccgaaggcgctcgatgaccttattataaccgcgaaaagccaa
ggaaagaagccattcttcgtgaatgccactgcgggtaccacggttgtaggcagtttcgac
cctctgccggaaatctctgagatctgccgaaagcacaacctttggttccatgtcgacggt
tcatggggaggctcctttattttctcctcaaagcagaaaagcaaacttacaggatcccat
cttgctgacagtattactttcaatccacataagatgctgggtgtgccggtcacttgttcg
ttcctcttggccgctgatattcgcaaattccaccgtgcaaacacgttaccagcgggatat
ctattccataacgaggaatacacgaagggattctgggacttgggtgacttgactctacaa
tgcggccgccgtgcagacgccctcaagctcttcctcagctggatgtactacggatctgag
ggctacgagcaaaagatcgactctgcttgtagtgttgctgagcatctttccaccgtcgtt
ggaaacaatcctcatctcattctccttactgagaatcccccaccctgtctccaagtttgc
ttttactatgctcctcttggacgcatggcataccccccaggaagagagatcaacggcaag
acactcagcgaagaagagagagccgaactcaacagccaaataaccgaagagattgttcaa
aaacttgtgccccaaggcttcatggtggactacgcacccccaagtgatggcgacactttt
gctaaggatggaaaatttttccgctgtgtggtcaatgttcttacgaaggaggaaacggtg
gattccctcgtgaatactattgtgaaacttggatcaaccattgtaaaacggcgactgggc
tcagagttgaacataccgactccgacagcacacccggcgcctacttccggattccgtcca
aagaaccctgcagaaagaggccatggaccagttgtctttgaataa

DBGET integrated database retrieval system