KEGG   Ciona intestinalis (sea squirt): 100181292Help
Entry
100181292         CDS       T01056                                 

Gene name
cipc2
Definition
(RefSeq) Neuroendocrine convertase 2-like
  KO
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     100181292 (cipc2)
Peptidases [BR:cin01002]
 Serine Peptidases
  Family S8: subtilisin family
   100181292 (cipc2)
Chaperones and folding catalysts [BR:cin03110]
 Intramolecular chaperones
  Subtilisin family
   100181292 (cipc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 660 aa AA seqDB search
MADNCYAGQTRSFSRALSYILLLTLMSWDTDLAGIRTGSLLVSAAKKRVYTNDFLVTIKS
AEPSSNHDHADWLAARHGFENRGMVVGDEGLYHFRHRTLDSASESPSLRYIWNLRLSPKV
QKVRQLEGYGRLKRGHNKVKVGAYQGLDPLYPYQWYINNTGQAGGKPGLDLNVQAAWNMG
YTGKGVTVAIMDDGLDYLHPDLRDNYSPEASYDFSSNDPYPYPRYTFNWFNSHGTRCAGE
VSSVADNGICGVGVAYDSKIAGIRMLDQPFMTDVIEAASMSFKPNLIDIYSASWGPTDDG
KTVDGPRQLTLRAIVNGVNKGRNGLGSIYVWASGDGGADDDCNCDGYAASMWTISVNSAI
NDGETALYDESCSSTLASTFSNGRGQRAGSGVATTDLYGQCTLRHSGTSAAAPEAAGVFA
LALDANKNLTWRDVQHLTVLTSTPNLLHDDLHRWQSNGVGLMFNHLFGFGVLNAQKMVKM
AKTWTTVPPRFRCEAGVVEQMFDIPSDGVLELTIDTDACDGGNNHVRYLEHVQAFLTIAS
SRRGDLTINMTSPFGTDSILLNRRPNDDDSSQGFRKWPFMTTHTWGEDPRGTWKLRVALN
GEFPQTGRLLRWGLLLHGTQQAPYIDEILDGHNSKLAVSKKLEFAEGILHDLEDSGSQHP
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaactgctatgccggccaaactcggtcgttttcgagggcgctgtcttatata
ctgctcctaacgctaatgagctgggacaccgacttggctgggattcgaaccggttcttta
ttggtttcggcggcaaagaaacgagtttatacgaacgactttctggtcacaatcaaatca
gctgaaccaagttcgaaccatgaccatgcagactggttagcagcaagacatgggtttgaa
aaccgaggcatggtcgtcggggacgaaggactttaccatttcagacaccgaaccttggac
tcggcttcggaaagcccgagtcttcggtacatatggaacttacgcctatctccaaaggta
caaaaagtgcgacagttggagggatatggaagacttaaacgtggtcacaataaagttaaa
gttggtgcctatcaagggcttgacccgttatacccctaccaatggtatattaataacact
ggacaagccggtggaaaacccggtttagatttaaacgtacaagctgcatggaacatgggg
tacacgggcaagggggtgactgttgctataatggacgatgggttagactatttgcacccg
gacttgcgagacaactatagcccagaggccagctacgactttagcagcaatgatccttac
ccttacccaagatacacatttaattggttcaacagccatggaacacgatgtgcaggtgaa
gtctccagcgtagcagacaacggtatatgcggggtaggggtcgcatatgattcgaagata
gctggaatacgtatgttggaccagccgtttatgacagacgtgattgaagcggcgtcgatg
tcttttaaaccgaacttgatcgatatttatagcgcatcatggggaccaactgatgatgga
aaaacagtggacgggccgaggcaactaacgctaagagcaatcgttaatggagttaataag
ggtcgcaatgggttgggatcaatatacgtgtgggcttcgggcgacggtggagcggacgat
gattgtaactgtgacggatacgcagcttcaatgtggacgatatcagttaattcagcgata
aatgacggagaaactgctctttatgatgaaagttgttcttctacattagcctctactttc
agtaatggtagaggacaacgtgcgggttcgggcgtggccaccaccgatttgtatggtcaa
tgtactttacgtcactcgggtacgtcagctgctgctccagaggcggcaggtgtgtttgct
cttgcgttggatgcaaacaagaatctcacctggagggatgtgcagcatcttactgtgctt
acttcgacgcctaacttgctccacgacgacctccaccggtggcaaagtaacggggttggt
ttgatgtttaatcatctgttcgggttcggggttttaaatgcacagaaaatggtaaaaatg
gcgaaaacttggacgacggttccaccccggttcagatgcgaagctggtgtcgttgagcag
atgtttgacattccgtcagatggcgtgcttgagctcactattgacactgatgcttgtgac
ggtggaaataaccatgttcgataccttgagcatgttcaggcgtttctgaccattgcaagt
tctcgccgtggagacttgaccataaatatgacgtctccgtttggcactgattccatatta
ttgaatcgacgaccaaacgacgacgacagctcacaagggtttagaaagtggccgttcatg
accacacatacatggggagaggacccaagaggaacttggaaattacgagtagctttgaac
ggagaatttccacaaacaggtcgtttgttacgttggggtttgcttctccacggtacccag
caagcgccttacatagacgagattttggatggacataactcaaagctggctgtgtcgaaa
aagctggaattcgctgaagggatacttcatgacttggaggacagtggttcccagcatccg
tga

DBGET integrated database retrieval system