KEGG   Ciona intestinalis (sea squirt): 100186234Help
Entry
100186234         CDS       T01056                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100186234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
4
AA seq 728 aa AA seqDB search
MSFFGRLKKCQCIGAPEEPKPVEGLQLKTVDCDWMSSENASDHHTTEYSAKYLILRRAQT
FTMKMKFQRKFHKTADRVVLELSLGTGSQLMNETKVRCPLVATLDPTKWGMVITHEEDET
FLVTFTVNIPPKALVGKYKSVVEFTSQLESGESVTTRDNEPELAILFNPWSKLDSVYMEN
EAEREEYCLNDLGIVYRGSKVRISGKKWNFGQFEENILECSLLLLDKDKRAKEKPNKWIQ
KRGDPVWISRAVSAMVNAQDDDGVLVGNWSGDYSGGVSPTKWNGSVEILQQYYNTGKPVS
YGQCWVFSGLVTTVLRSLGIPTRSVTNFASAHDTEGSMTIDNYVDESGEEINLGGDSVWN
FHVWNECWMKRGDLPTGYDGWQAVDATPQEISLGLYQTGPAPLTAIKNGEVYLGFETAFV
FAEVNSDRTNWIVKQDEGGEYVIETLGSRFPKSVGKYISTKSVGTDDRLDVTNLYKYTED
SAEEREAFKKAYAFGTLPEYQAGFLSVEEEGKGVSIDFSTAPNIRNGDGFAIVITAQNDS
AEKVTVDISAVLHSTLYTGEKRRFIKRQRFSAIPVDTNSTVSRDFNVMFSDYNGKLVDLN
SLRLSAVVKVKETGKMFADSYEFRLDNKEAIDIQVENTLQINKEYQVLVNFSNPLPTRLT
NVVVTLEGPGLSEPLTRKLNRNVVAGGTAQFSFPIQPKKVGKKSILVDVDAKQVKDLKNF
IDVEVVSS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctttggccgcctaaagaaatgtcaatgcataggagcaccggaagaaccaaaa
ccagtcgaaggcctgcagctgaaaacggtggactgcgactggatgtcatcagaaaatgcc
tccgaccaccacaccaccgaatactctgcgaaatatctgattttacgccgtgcccagacc
ttcacgatgaaaatgaaattccagagaaaattccacaaaacagcagatcgggtagtactg
gaactcagcttaggtacgggttcacagttgatgaacgaaactaaagttcgctgtccactg
gttgctacacttgacccaacaaagtggggaatggttataactcacgaagaagatgaaacg
ttcttggttacgtttacagtgaacattccacctaaagcgttggtcggcaaatacaagtca
gtggttgaattcaccagccaactagaaagtggggaatcggttacaacacgtgacaatgaa
ccggagttggcaattcttttcaatccttggtcgaaattggactcagtgtacatggaaaac
gaggctgaacgtgaagaatattgtttgaatgatcttgggatagtatacagaggttcaaag
gttcgaatcagtggaaaaaagtggaattttggccagtttgaggaaaatattttggaatgt
tcattgcttctacttgataaagacaagcgagcaaaagagaaaccgaacaagtggattcaa
aagcggggcgacccagtttggatttctagagctgtatcagcaatggtaaacgctcaagac
gatgacggtgtcttggtcgggaattggtccggcgactattcgggcggagtatcccctacc
aaatggaacggaagtgtggagatattacagcagtactacaacacggggaagcccgtatcg
tatggacagtgttgggttttctctggtcttgttacaacagtactacggagcttaggaata
ccaacaagaagcgtcacgaactttgcctcagcacacgacacagagggcagtatgacgatt
gataattacgttgacgagagcggagaagaaattaatctcggtggagacagtgtctggaac
tttcatgtttggaacgaatgttggatgaaacgaggcgatcttccaactggttacgacggt
tggcaagcagtggatgcaactccacaagaaataagtcttggactttatcaaactggaccg
gcccctctcactgctattaaaaacggggaagtatacttgggttttgaaacagcttttgtg
ttcgctgaggtaaattcagatcgcacaaattggatagtaaagcaagatgaaggaggagaa
tatgtaattgaaacccttggatcgaggtttccaaaatctgttggtaaatacatcagcaca
aagtctgtgggtaccgacgatagactggatgtaacgaacttgtacaaatacactgaagat
agtgccgaagaaagagaggcttttaaaaaagcgtatgcattcggaactttaccagaatac
caggctggattcctctcggtagaagaagaaggaaaaggggttagcattgatttctctact
gcacctaacatacgaaatggggatggttttgctatcgtgatcacagcacagaacgattct
gctgaaaaagtgacagtcgatatttctgctgttctgcactcaacattatacactggtgaa
aagagaaggttcatcaaaagacagcgattttctgctattcctgttgatacaaattcaact
gtctcccgtgacttcaatgtaatgtttagtgactacaacggcaaacttgtcgatctcaat
tctttacgactctcagctgttgtcaaagtgaaagagactggcaagatgtttgctgatagc
tatgagtttcgacttgacaacaaggaagcaatagatatacaggtagaaaacacgctacaa
atcaataaagaatatcaggttttagtgaacttctcgaatccactgccaacaagactcaca
aacgttgttgttactttagaagggcctggactgagcgaacctcttacacggaaactaaat
cgtaatgttgtagctggaggtacagctcaattctcttttcccattcaaccaaaaaaagtc
ggaaaaaaatcaattctggttgacgttgatgcaaaacaagtaaaggatttgaaaaacttc
attgacgtagaagttgtaagttcttga

DBGET integrated database retrieval system