KEGG   Citrus sinensis (Valencia orange): 102628801Help
Entry
102628801         CDS       T02983                                 

Definition
(RefSeq) glutathione S-transferase zeta class-like
  KO
K01800  
maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cit00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    102628801
Enzymes [BR:cit01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     102628801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
3
AA seq 212 aa AA seqDB search
MLKLYSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPDFLKINPIGYVPALVDGD
FVVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKA
GADERDIWAKTHIGKGFAALEKLLKDYAGKYATGDEVFLADLYLAPQLYAAVNRFNLDMT
QFPLLLRLHEAYSKLPAFQNAAPEKQPDAPSS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaactgtattcatactggaggagttcatgctcacatcgtgtcagaattggtctc
aacttgaaagggttagaatatgagtacaaagcagttaacttggtgaaaggagagcaattc
agtcctgattttttgaagatcaaccctattggctatgtgccggctttggttgatggagat
tttgttgtatctgattcttttgccattttaatgtacctggaagagaagtatcctcagcct
ccattgttgccttctgatcttaagagaaaagctatcaattatcaggctgcaaatattgtt
tcctcgagcatacagcctcttcagaatcttgcagtagtgaagtacattgaggaaaaagct
ggtgcagatgagagagatatctgggctaaaactcacattggaaaaggctttgcggcactt
gagaagctgctaaaagactatgctgggaaatatgcaactggagatgaagttttcctggca
gatttgtatctggcaccgcagctttatgcagcggtcaacaggttcaaccttgacatgacc
caattccctcttttgctgaggttgcatgaggcatacagcaagctaccggcatttcaaaat
gctgcaccagaaaaacaaccggatgccccttcatcatga

DBGET integrated database retrieval system