KEGG   Cellvibrio japonicus: CJA_2927Help
Entry
CJA_2927          CDS       T00721                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cja  Cellvibrio japonicus
Pathway
cja00473  D-Alanine metabolism
cja00550  Peptidoglycan biosynthesis
cja01100  Metabolic pathways
cja01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CJA_2927
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CJA_2927
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CJA_2927
Enzymes [BR:cja01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CJA_2927
Peptidoglycan biosynthesis and degradation proteins [BR:cja01011]
 Precursor biosynthesis
  Amino acid ligase
   CJA_2927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter ATP-grasp RimK ATPgrasp_YheCD TTL ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACE86079
UniProt: B3PCL8
LinkDB All DBs
Position
complement(3432858..3433844)
Genome map
AA seq 328 aa AA seqDB search
MQAVKLPIDETLKQQLGRVGVLYGGLSAEREISLQSGAAVIAALEDAGIDHVAIDVGDNV
IADIQAANIDRAFLMLHGPGGEDGRIQALLEFLHIPYTGSDVQSSALAMDKLRTKFLWCG
YSQSSAQHLPTPEFAVLTRESDFVAELKRLGGEVMVKPANEGSSIGMSRVKTAEDLQAAF
VKATDYQGSVLAERLIVGAEYTVAILDGEALPPIRLETDHSFYDFNAKYIAEDTRYICPC
GLSAEKEQELKQLALTAFNVLGCRGWGRVDVMADAQQNFYLLEVNTAPGMTSHSLVPMAA
KAVGLSFTELVVTILRASLVTAGSEVVA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagtcaagctgcctattgatgaaacattgaagcaacagttggggcgtgtcggc
gtgctctatggtggcctgtctgcggagcgcgagatttcgctgcaaagtggtgctgcggtg
attgctgcgctggaggacgcgggtatcgatcatgttgccattgatgtgggtgacaatgta
attgccgatatccaggccgccaatatcgatcgtgcatttttgatgttgcacggccccggt
ggtgaagacggtcgtattcaggcgttattggagtttttacatattccctataccggcagc
gacgtgcagtcctcggccctggcgatggacaaactgcgtaccaaatttttatggtgtggt
tacagtcagagttctgcgcaacatttgcctacaccggaatttgcggtgctcacgcgcgaa
tcagattttgtggctgagttgaaacgcctcggtggggaagtgatggttaaacctgccaac
gaaggttccagtatcggtatgtcgcgggtaaaaacggcagaagatttacaggccgccttt
gtaaaggcgactgactatcaaggcagtgtactggctgaacgtttgattgtcggtgcggaa
tataccgttgccatccttgatggcgaggccttgccccccatccgactggaaactgaccac
agcttctacgacttcaatgccaaatatattgctgaagatactcgctatatctgcccttgc
ggcttgtctgctgaaaaagaacaggaactaaagcagttggcattgactgcctttaatgtc
ctggggtgccgcggttgggggcgtgttgatgttatggctgacgcacaacaaaatttttat
ttgttggaggtgaataccgcaccgggaatgacgagccatagcctggttcccatggccgca
aaagcagtagggttaagttttaccgaattggttgtcaccattctgcgtgccagccttgtg
accgcaggcagtgaggttgttgcgtag

DBGET integrated database retrieval system