KEGG   Corynebacterium jeikeium: jk0998Help
Entry
jk0998            CDS       T00255                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase (EC 4.1.1.31) (PEPCase) (PEPC).,Through the carboxylation of phosphoenolpyruvate (PEP) it forms oxaloacetate a four-carbon dicarboxylic acid source for the tricarboxylic acid cycle.
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cjk  Corynebacterium jeikeium
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    jk0998 (ppc)
  Energy metabolism
   00680 Methane metabolism
    jk0998 (ppc)
Enzymes [BR:cjk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     jk0998 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1179465..1182311)
Genome map
AA seq 948 aa AA seqDB search
MSKDTIRGTAIPVAPEEIAHPEISPTVRDDTRYLGRILGEVIREQEGDYTFNLIENTRSA
AFDLRYGEMPIEELAEQFNKLPTEKALPVIRAFSHFALMANLAEDLYVERVRDLEEDRGN
TAPRSTLAYTWQELHNREVPGEKVAETMANALVAPVLTAHPTETRRRTVFDVQTDIMKMM
RRRARVLKELKLNPDSVRSARQLAEIELVIRRRMTLLWQTSLIGSVRPRIEDEIKVGLRY
YGISLLSEIPAINRRVNEHMKEQYGDVVPRTAVVRPGSWIGGDHDGNPYVTAETVGIATT
FAARTIFDHYQKTIYALEHELSLSSKFIDTTEALEQLADRGRNDVPSRVDEPFRRALHGM
RGRVAATAKHTLGEPVVSGGIHKGHEPYANPAELLADIDTVDEALRHSMDDLLADHTLAD
LREAVETFGFNLYSLDLRQNSESFENVLTEVFARAGVAENYAELDEDAKVELLLTELASP
RPLADPEAEWSEETARELGIFRAAAKAAKKFGAEVVPHCIISMASSVSDVIEPMILLKEV
GLIQANGEHPQGSVDIIPLFETIDDLAGGADIMRQLWQLPLYRNYVAGRGDIQEIMLGYS
DSNKDGGYFAANWALYDAELALVEASREAGLFLRLFHGRGGTVGRGGGPSYDAILAQPKG
AVQGAVRITEQGEIISAKYGDPANASRNLEALVAATLEASLLPVDDLDDPDVAFETMRQI
AEESRKAYSALMHEDPGFIEYFTTSTPLAEIGSLNIGSRPSSRKQTTAVSDLRAIPWVLS
WSQSRVMLPGWFGVGSALKRWIEDGSSVSGDATSRLNYLRELHRRWPFFDSVLSNMAQVM
SKADLSIAQLYSELVGDREAAERIFDVIVEEYKLTVEMFLQITERETLLADNPELVSSVR
NRFPYLVPLNLLQVELLRRFRAGDDSDSVRSGIQLTMNGLATALRNSG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagacacgatccgcggcaccgcaattcccgtcgctcccgaagagatcgcccac
cctgagatcagcccgacggtgcgggacgatacccgctacctggggcgcatcttgggcgag
gtgatccgcgagcaggagggtgactacaccttcaacctgatcgaaaacacccgcagcgcg
gctttcgacctgcgttacggcgaaatgcctatcgaggagctcgccgagcagttcaacaag
ctgccgactgaaaaggcactgccggtcatccgcgcgttctcccacttcgcgttgatggcg
aacctggcggaagacctgtacgtcgagcgggtgcgtgacctcgaggaggatcgcggcaac
accgcgcctcgctccacactggcctacacctggcaggagctgcacaaccgtgaggtgccg
ggggagaaggtcgccgagaccatggcgaacgctctggtagcacccgttttgacggcgcac
ccgacggaaactcgccggcggaccgtgttcgacgtgcagaccgacatcatgaagatgatg
cgccgccgcgcacgtgtgctcaaggagctgaagcttaaccccgattcggtgcgttcggcc
cgtcagctggccgagatcgagttggtgatccgccgccggatgacgctgctgtggcagacg
tccctgatcggcagcgtgcgtccgcgcatcgaggacgagatcaaggtggggctgcgctac
tacggcatcagcctgctcagcgagattccggccatcaaccgccgcgtgaacgagcacatg
aaggagcagtacggagacgtggtgccccgcaccgcggtagtgcgccccggctcgtggatc
ggcggtgaccacgacggcaacccgtacgtgacggcggaaacggtgggcatagccacgacc
ttcgccgcgcgcactatcttcgaccactaccagaagactatctacgcgctggagcacgag
ctcagcttgtcctccaagttcatcgacacgaccgaagcgctggagcaactggccgaccgt
gggcgcaacgacgtgccttcccgcgtagacgagcccttccgccgcgccctccacggtatg
cgtgggcgcgtggctgccacggccaagcacaccctgggagagccggtggtctccggaggc
atccacaagggccacgagccctatgccaatccggcggagttgttggcggacatcgacacg
gtcgacgaggctctgcgtcactccatggacgacctgctggccgaccacaccctggcggac
ctgcgggaggccgtagagaccttcggcttcaacctgtactcgctggatctgcgccagaac
tccgagagcttcgagaacgtgctgacggaagtcttcgcccgcgcgggagtggcggagaac
tatgccgagttggacgaggacgcgaaggtggagctgctgctgacagagctggccagcccg
cgcccccttgccgacccggaggccgaatggtcggaggagaccgcccgcgagctcggcatc
ttccgcgccgccgcgaaggctgccaagaagttcggcgcggaggtggtgccgcactgcatc
atctctatggcctcgtccgtctccgacgtgatcgagccgatgatcctgctcaaggaagtc
gggcttatccaggcgaacggcgagcacccgcagggatccgtggacatcattccgctgttc
gagaccatcgacgaccttgccggtggtgcggacatcatgcgccagctctggcagttgccg
ctgtaccgcaactacgtagccgggcgcggagatatccaggagatcatgctgggctactcc
gattccaacaaggacgggggctacttcgccgccaactgggcgctctacgacgcggagttg
gcgctggtcgaagcctcccgcgaggccgggctgttcctgcgcctgttccacgggcgtggc
ggcaccgtcggccgcggcggcggtccatcctacgatgcaatcctggcgcagccgaagggc
gcggtgcagggtgcggtgcgcatcaccgagcagggcgagatcatctccgccaagtacggc
gaccccgccaacgcctcccgcaacctggaggctctcgttgccgcgaccttggaggccagc
ctgctgcccgtcgacgacctcgacgaccccgacgtggccttcgagaccatgcggcagatc
gcggaggagtctaggaaggcttactctgcgctgatgcacgaggacccgggcttcatcgag
tacttcaccacctccacgccgctggcggagatcggcagcctgaacatcggctcccgcccc
tcctcgcgcaagcaaaccaccgcggtctcggatctgcgcgccatcccgtgggtgctcagc
tggtcgcagtcgcgcgtgatgctgcccggttggttcggagtgggcagcgccctgaagcgg
tggatcgaagatggttcttctgtatctggtgacgccacctcgcgcctcaactacctgcgg
gagctccacaggcgctggcctttcttcgactcggtgctttctaatatggcccaggtgatg
tctaaggcggacctttccatcgcgcagctgtactccgagctggtgggcgatagggaggcg
gcggagcgcatcttcgacgtgatcgtcgaggaatacaagctgaccgtggagatgttcctg
cagatcaccgagcgggaaaccctgctggcggacaacccggagctggtcagctccgtgcgt
aaccgcttcccgtacctggtgccgctgaacctgctgcaggtggagctgctgcgccgcttc
cgcgccggcgacgattccgatagcgtgcgttcgggcatccagctgacgatgaacggtttg
gccaccgcgctgcgcaactcgggttag

DBGET integrated database retrieval system