KEGG   Comamonas kerstersii: B5M06_08820Help
Entry
B5M06_08820       CDS       T04758                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cke  Comamonas kerstersii
Pathway
cke00250  Alanine, aspartate and glutamate metabolism
cke00410  beta-Alanine metabolism
cke00430  Taurine and hypotaurine metabolism
cke00650  Butanoate metabolism
cke01100  Metabolic pathways
cke01110  Biosynthesis of secondary metabolites
cke01120  Microbial metabolism in diverse environments
cke02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cke00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    B5M06_08820
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B5M06_08820
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B5M06_08820
   00430 Taurine and hypotaurine metabolism
    B5M06_08820
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    B5M06_08820
Enzymes [BR:cke01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     B5M06_08820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AQZ98339
UniProt: A0A1V0BEH5
LinkDB All DBs
Position
1888476..1889855
Genome map
AA seq 459 aa AA seqDB search
MAQNLNDDIYASRELLSSLPKKRFPENELNGRNVFSAVRDELMLDGNSRQNLATFCQTWV
DDYARAIMDLSIDKNMIDKDEYPQTAEIESRCVHMLADLWNSPSPETTLGCSTVGSSEAA
MLGGLALKWQWRKKRAAQGKSTDRPNMVCGPVQICWHKFARYFDVEIREVPLEGDRMIMN
PDEVLKRVDENTIGVVPTMGVTFTCQYEPVKAIHDALDKLQQETGLDIPMHVDGASGGFL
APFCAPEIEWDFRLPRVKSINSSGHKFGLAPLGVGWVIWREAKDLPEELIFNVNYLGGNM
PTFALNFSRPGGQVIAQYYNFLRLGREGYAKVHGACYETAMYLAKEIEKLGDFKIIFDGN
PKHGIPALAWTLKNPDAINGYTLYDFADRLRSRGWQVPAYSMPANREDLVVQRILVRHGV
SRDLGSLLIEDMKRALEYFKAHPVSNPLTEKEAGGFSHR
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaacctgaatgacgatatttatgcatcgcgagagctgctatcgtcgttgccc
aaaaagcgttttccagaaaacgagctcaatggccgcaatgtgttcagcgccgtacgtgac
gagctgatgctggacggcaattcgcgccagaacctggccaccttctgccagacctgggtg
gatgactatgcgcgcgccatcatggacttgtcgatcgataagaacatgatcgacaaggac
gaatacccacagactgcagaaattgaaagccgctgcgtgcacatgctggcggatctgtgg
aattcaccttcgccagaaaccaccctgggctgttccaccgtgggttcttcggaagcggcc
atgctgggtggtctggcgctgaagtggcagtggcgcaagaagcgtgcagcgcagggcaag
tccaccgaccgccccaacatggtctgcggccccgtgcagatctgctggcacaagtttgcg
cgctactttgatgtggaaatccgcgaagtgccgctggaaggcgatcgcatgatcatgaat
ccggacgaagtgctcaagcgcgtggacgaaaacaccattggcgtggtgcccaccatgggc
gtgacctttacctgccagtacgagcccgtcaaagcgattcacgatgcgctggacaagctg
cagcaggaaaccggtctggatattcccatgcacgtggacggcgccagtggcggcttcctg
gcgcccttctgtgctcctgaaattgaatgggacttccgcctgccccgcgtgaagtccatc
aactcctccggccacaagtttggtctggcaccactgggtgtgggctgggtgatctggcgt
gaagccaaggatctgcccgaagagctgatcttcaacgtcaactacctgggcggcaatatg
cccacctttgcgctgaatttctcgcgccccggtggccaggtgattgcgcagtactacaac
ttcctgcgtctgggccgcgaaggctacgccaaggtgcacggtgcctgctatgagaccgcc
atgtacctggccaaggaaattgaaaagctgggcgacttcaagatcatctttgatggcaac
cccaagcacggcattcctgcgctggcctggacgctcaagaaccccgatgccatcaacggc
tacaccctgtatgacttcgcggaccgcctgcgcagccgtggctggcaggtgccggcctac
tccatgcctgccaaccgtgaagacctggtggtgcagcgcattctggtgcgccacggcgtg
agccgcgatctgggctccttgctgattgaagacatgaagcgtgcgctggagtacttcaag
gcgcaccctgtctccaacccgttgacggaaaaggaagcaggtggatttagccatcgttaa

DBGET integrated database retrieval system