KEGG   Caldicellulosiruptor kristjanssonii: Calkr_2153Help
Entry
Calkr_2153        CDS       T01356                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Calkr_2153
Enzymes [BR:cki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Calkr_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2207943..2208512)
Genome map
AA seq 189 aa AA seqDB search
MINNYVGKLIVYTGSMFSGKTTQLLETLRRFQIAGYSTMLFKPSIDTRYSISEVVNHPKN
YRFSAVSIEYIEDIERYAENVQVIGIDEFQFIKSIFGPLKTINKLLLRDKTIIIAGLDID
FQGRPFESMKEVLPVADYVYKLHAICVNCGQDAWISHRITDEGERIVIGAEEKYQPLCRR
CFYRVTQGK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgattaataactatgttggcaaactaattgtctacaccggaagtatgttcagtggaaaa
acaacacagctactggaaaccctgagaaggttccagatagcgggatattcaactatgctg
ttcaaaccatcaatagatacacggtacagtatttcagaagttgttaaccatcccaaaaac
tacagattttctgctgtcagtatcgagtatatagaagacatagaacgatatgctgaaaat
gtccaggttattgggatagacgagttccagtttatcaaatcaatatttggtcctctgaaa
acaatcaacaaattgcttctcagggacaaaacaataattattgcaggactggacattgac
tttcagggaagaccattcgaaagcatgaaagaagtgctgcctgttgcggactatgtgtac
aagctgcatgcaatatgtgttaattgcggacaggatgcatggatttctcatcgaatcaca
gacgaaggggagagaatcgtaataggcgcagaagaaaagtatcaacctttgtgcagaagg
tgcttctacagagtcactcaggggaagtaa

DBGET integrated database retrieval system