KEGG   Clostridium kluyveri DSM 555: CKL_2771Help
Entry
CKL_2771          CDS       T00564                                 

Gene name
sod
Definition
(GenBank) Sod
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ckl  Clostridium kluyveri DSM 555
Brite
Enzymes [BR:ckl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CKL_2771 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2847141..2847797
Genome map
AA seq 218 aa AA seqDB search
MYNMKPEVFNFNSVKGISQRQLNEHYKLYVGYVNILNQIWNTDYTPQNYTDSNPTYSKMR
SLKLGETYALNGVKLHNLYFKNMTGGNTTPHGPVLNSIINQFSSYDNFLSYLTNVGLSMR
GWAILSIDSLDNKFHIIGSDLHDKGSVWISYPILVMDVYEHAYFMDFGTNKKEYISTFIK
NINWTVVNKRFQKYLHLLQILNINHNRYIPYEFLNRHI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtataatatgaaacctgaagtttttaactttaattctgttaaaggtatttcccaaaga
caactaaatgaacattataaattatatgtgggctatgtaaatattttaaaccaaatctgg
aacactgattatacccctcaaaattatactgatagtaatccaacctattcaaaaatgcga
agcttaaaacttggtgaaacctatgcactaaatggggtaaaacttcataatctttacttc
aagaatatgacaggaggcaataccactccccatggtccggtacttaactccataataaat
caattctcatcttatgataattttctttcttatttaacaaatgtaggtctatccatgaga
ggatgggcaattctgtctatagattcactagacaataaattccacataataggaagtgat
ctgcacgacaaaggatctgtgtggatttcttaccctatattagtaatggatgtttatgaa
catgcttattttatggattttggaacaaataaaaaagaatatatttctactttcattaag
aatataaattggactgttgtaaataaaagattccaaaagtaccttcacttattgcagatt
ttaaatataaatcacaatagatatattccatatgaatttctcaatagacatatttaa

DBGET integrated database retrieval system