KEGG   Citrobacter koseri: CKO_04845Help
Entry
CKO_04845         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cko  Citrobacter koseri
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CKO_04845
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CKO_04845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4448017..4449525
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGADSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKHTWQARGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIDESEINYLLKVYNAHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLSSYYQGIGPAWTKECVLPGGDIGGDREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWILGEATSVAELGEDFGHELYEAELKYLVDHEWVRRADDALWRRTKEGMWLNAE
QQSRVSQWLAEYIGKRQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggcgggggcattaacggtgcgggtatcgcggca
gacgccgccggacgtggtttatccgtgctcatgctggaagcgcaggatttggcctgtgca
acctcttccgccagctctaaattaattcacggtggcttgcgctaccttgaacactacgaa
ttccgcctggtcagcgaagcgctggccgaacgtgaagtgctgctgaaaatggcgccgcac
atcgccttcccgatgcgcttccgcctgcctcaccgcccgcacctgcgcccggcatggatg
atccgaattggtttgtttatgtacgatcatctgggcaaacgcaccagtctgcccggttca
accggtttgcgttttggcgcagattcggtgctgaaaccggagatcgtgcgcggtttcgaa
tattctgactgctgggtagacgatgcgcgtctggttctggcaaacgcccaaatggtggtg
cgtaaaggcggggaagtgttaacccgtacccgagcgacctctgcccgtcgtgaaaacggt
ctgtggatcgtagaagcggaagatatcgataccggtaaaaagcacacctggcaggcgcgt
ggtctggtcaacgccacggggccgtgggtaaaacagttcttcgacgacggtatgcacctg
ccttcaccctacggcattcgtctgatcaaaggcagccacattgtggtgccgcgcgtgcat
acgcagaaacaggcttatatcctgcaaaacgaagataagcgtatcgtatttgtgattccg
tggatggatgagttctcaatcatcggcaccactgacgtggagtacaaaggcgatccgaaa
gcagtgaaaattgatgaaagcgaaatcaattacctgctgaaagtctataacgcgcacttc
aagaaacaactgggccgcgacgatatcgtctggacctactccggcgtgcgtccgctgtgc
gatgacgagtccgattctccgcaggcgatcacccgtgactacacgctggatatccacgat
gaaaacggcaaagcgccgctgctgtcggtattcggcggtaagctgaccacttatcgtaag
ctggccgaacacgcaatggaaaaactgtcgtcctattaccagggcattggcccggcctgg
actaaagagtgcgtgcttcctggcggggatatcggcggcgatcgtgaagattacgcggcc
aaactgcgccgccgctatccgttcctgacggagtcgctggcgcgtcattattcccgcacc
tacggcagcaataccgagtggatactcggcgaagccacctccgttgccgagttaggtgaa
gatttcggtcacgaactttacgaagcggagctgaagtatctggtggatcacgaatgggta
cgtcgcgcggacgacgcgttgtggcgccgcaccaaagaagggatgtggctcaacgccgag
cagcagtcccgcgtgagccagtggctggcggaatatattggcaaacgtcagttgtcgctg
gcgtcgtaa

DBGET integrated database retrieval system