KEGG   Citrobacter koseri: CKO_04884Help
Entry
CKO_04884         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cko  Citrobacter koseri
Pathway
cko00250  Alanine, aspartate and glutamate metabolism
cko00410  beta-Alanine metabolism
cko00640  Propanoate metabolism
cko00650  Butanoate metabolism
cko01100  Metabolic pathways
cko01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CKO_04884
   00650 Butanoate metabolism
    CKO_04884
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CKO_04884
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CKO_04884
Enzymes [BR:cko01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CKO_04884
Amino acid related enzymes [BR:cko01007]
 Aminotransferase (transaminase)
  Class III
   CKO_04884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABV15928
UniProt: A8AR15
LinkDB All DBs
Position
complement(4484629..4485894)
Genome map
AA seq 421 aa AA seqDB search
MKNNELNERRLQATPRGIGVMCGFYADRAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VIAAIEKQLQSFTHTAYQIVPYASYVTLAERINERVPVNGPAKTAFFSTGAEAVENAVKI
ARACTRRPGLITFGGAFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAQYPNPLHGVTTA
DALNSLERIFKADIAPDQVAAIILEPVQGEGGFNVAPTDFMQALRTLCDTHGILLIADEV
QTGFARTGKLFAMEHYGVQPDLITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEEDDLCTRATQLGQHLVEVLNKAKAACPSIAEIRAQGSMVAVEFTD
PQTGQPSPEFTRQVQDRALQEGLLLLSCGVYGNVIRFLYPLTIPDAQFRKALEIITRSLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataacgaactgaatgaaagacggttgcaggcgacgccgcgcggcatcggggtg
atgtgcggtttctatgccgacagagcggaaaacgccacgctgtgggatattgaaggcaat
gaggtgattgatttcgccgccggaattgccgtgttgaacaccgggcaccgtcatccaaaa
gtcatcgcggcaattgaaaaacagctccagtcatttacccataccgcgtatcaaatcgtg
ccttatgcaagctacgttacgcttgccgagcgtattaacgagcgcgtgccggtcaacggc
ccggcgaaaacggctttcttctccaccggcgcggaggcggtcgaaaacgcggtgaaaatt
gcgcgcgcctgtacccgacgaccggggctgattacctttggcggcgcgtttcacgggcga
acctttatgacgatggcgctcaccggtaaggtcgcgccctacaaaattggctttgggccg
ttcccgggatcggtctatcacgcgcaatatccgaatcctttgcatggcgttaccacggcg
gatgcgctgaacagtctcgaacggatttttaaagccgatattgcgccggaccaggtggcg
gccattatcctggaaccggtgcagggggaagggggctttaacgtcgcgccaacggatttc
atgcaggcgctgcgtacgttatgcgatacccacggcatcttgctgatcgccgatgaagtg
cagaccggttttgcccgtacaggcaaactgtttgcgatggaacactacggcgttcagccg
gatctcatcacgatggccaaaagtctggccggcggtatgccgctgtcggcggtatccggt
cgcgccgaggtgatggatgcgccagcgccgggcggtcttggcggcacctacgccggaaac
ccgctggcggtggccgccgcgcatgcggtgcttgatgtgattgaagaagacgatctctgc
actcgcgccacgcagcttggtcagcatctggttgaggtgttgaacaaagcgaaagccgcc
tgcccgtccattgccgagatccgcgcgcagggctcgatggtggcggtagagtttaccgat
ccgcaaaccggccagccgtccccggaatttacccggcaggtgcaggatcgcgcattgcag
gagggtctgctgctgctcagctgcggtgtttacggcaacgtgatccgcttcctctatccg
ctgacgatccccgatgcgcagttccgtaaagcgctggagatcattacgcgttcgctgaca
cgataa

DBGET integrated database retrieval system