KEGG   Clostridium sp. BNL1100: Clo1100_0344Help
Entry
Clo1100_0344      CDS       T01708                                 

Definition
(GenBank) translation elongation factor TU
  KO
K02358  
elongation factor Tu
Organism
clb  Clostridium sp. BNL1100
Brite
Translation factors [BR:clb03012]
 Eukaryotic Type
  Elongation factors
   Clo1100_0344
 Prokaryotic Type
   Clo1100_0344
Mitochondrial biogenesis [BR:clb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Clo1100_0344
Exosome [BR:clb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Clo1100_0344
  Exosomal proteins of breast cancer cells
   Clo1100_0344
  Exosomal proteins of colorectal cancer cells
   Clo1100_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
386023..387225
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERNKPHVNIGTIGHVDHGKTSLTAAITKVLGFSGRAEYKAYDQIDAAPEERERG
ITINTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSHQVGVPYIIVFLNKCDMVDDEELIELVEMEVRELLSTYEFPGDDTPIVRGSALVALE
SNSTDINAPEYAPIVALMAEVDKYIPTPERATDKPFIMPVEDVFSITGRGTVATGRVEKG
IVKVGDEVEIVGLMEAPKKTVVTGVEMFRKLLDQAQAGDNIGALLRGVQRNEIERGQVLA
KPGSIKPHTYFEGQVYVLTSAEGGRHKPFFNGYRPQFYFRTTDVTGVIEIPEGTEMVMPG
DHITMKIKLITPIAMDEGLKFAIREGGRTVGAGNVSKIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggctaaattcgaaagaaacaaaccccacgttaatatcggaacaattggtcac
gttgaccatggtaagacttctttaacagctgctatcactaaggttcttggattctcagga
agagctgaatacaaggcatacgaccaaatcgatgctgctccagaagaaagagaaagaggt
attacaatcaataccgctcacgttgagtacgaaactgaaacaagacactacgctcacgtt
gactgcccaggccatgccgactatgttaagaacatgatcactggtgctgctcagatggac
ggtgctatcctcgttgtttcagctgctgacggcccaatgcctcagacaagagaacacatt
cttctttcacaccaggttggtgttccttacatcatcgtattcttgaacaaatgcgatatg
gttgatgatgaagaacttatcgaattggttgaaatggaagttagagaattgttgagcaca
tatgaattcccaggtgatgatactcctatcgtaagaggttcagctcttgtagctctggaa
agtaattcaactgatataaacgctcctgaatatgctccaatcgttgctcttatggcagaa
gttgacaaatatatcccaactcctgaaagagctactgacaagccatttatcatgcctgta
gaggatgttttctcaatcacaggtcgtggtactgttgctactggtagagttgaaaagggt
atcgttaaggttggagacgaagttgaaatcgttggtttgatggaagctccaaagaaaact
gttgtaactggtgttgaaatgttcagaaagcttcttgaccaagctcaagctggtgacaat
attggtgctctcttaagaggtgttcagagaaacgaaatcgaaagaggacaggttctcgct
aagccaggatcaatcaagcctcacacttactttgaaggtcaggtttacgttttgacttct
gctgaaggtggaagacataagccattcttcaatggttacagaccacagttctatttcaga
acaactgacgttacaggtgttatcgaaattccagaaggaacagaaatggttatgcctggt
gaccacatcactatgaagatcaaattgatcactcctatcgctatggatgaaggacttaag
ttcgctatccgtgaaggtggtagaacagttggtgctggtaacgtttcaaagattatcgaa
taa

DBGET integrated database retrieval system