KEGG   Caldicellulosiruptor lactoaceticus: Calla_1304Help
Entry
Calla_1304        CDS       T01600                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
clc  Caldicellulosiruptor lactoaceticus
Brite
Translation factors [BR:clc03012]
 Eukaryotic Type
  Elongation factors
   Calla_1304
 Prokaryotic Type
   Calla_1304
Mitochondrial biogenesis [BR:clc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Calla_1304
Exosome [BR:clc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Calla_1304
  Exosomal proteins of breast cancer cells
   Calla_1304
  Exosomal proteins of colorectal cancer cells
   Calla_1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1368096..1369298)
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLSLKGKAQFMAYDQIDKAPEERERG
ITINTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVNVPYIVVFLNKVDMVDDPELIELVEMEVRELLSKYGYPGDEVPIVKGSALKALE
STSQDPNAPEYQCILELMDAVDKYIPTPQRDVDKPFLMPIEDVFSITGRGTVVTGRVERG
TLKTGEEVEIVGFAPEPRKTVVTGIEMFRKVLDEAVAGDNVGCLLRGIQKNEVERGQVLA
KPGTIKPHTKFKAQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGTITLPEGVEMCMPG
DNVEMTVELISPIAIESGLRFAIREGGRTVGAGSVTTIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaaatttgaaagaacaaaaccacacgtaaacataggtacaattggacac
gttgaccatggaaaaacaacattgacagctgcaatcacaaaggttttgtctctcaaaggt
aaagcacagtttatggcttatgaccagattgacaaggctccagaggaaagagaaagaggt
attacaatcaacacagcacacgttgagtatgagacagacgcaagacactatgcacacgtt
gactgcccaggtcacgctgactacgtcaagaacatgataacaggtgctgctcagatggac
ggtgcaatcttggttgtatctgcagcagacggtccaatgccacagacaagagagcacatt
ttgcttgcacgacaggttaacgttccatacatcgttgtattcctcaacaaggttgacatg
gtagacgacccagaattgattgagcttgttgaaatggaagtaagagaacttctttcaaag
tatggctatccaggcgacgaagtaccaatagtaaaaggttctgcgctgaaggctttagag
tcaacatcacaagatccaaatgctccagaatatcagtgcattttagagctcatggatgct
gttgacaaatacattccaacaccacagagagacgttgacaaaccattcttgatgccaatt
gaagacgtgttctcaatcacaggtagaggtactgttgtaacaggtagagttgaaagagga
acactcaagacaggcgaagaggttgaaatagttggttttgctccagagccaagaaagaca
gttgtaacaggtattgagatgttcagaaaggtacttgacgaggctgttgctggtgacaat
gtagggtgtcttctcagaggtattcagaagaatgaggttgaaagagggcaggttcttgca
aagccaggcacaattaaacctcatacaaaattcaaagcacaggtttacgtcttgacaaaa
gaagaaggtggaagacatacaccattcttcaatggttacagaccacagttctatttcaga
acaacagacgttacaggaacaatcacactaccagaaggtgtagagatgtgcatgcctggt
gacaacgttgagatgacagttgagcttatctctccaatcgctattgagtcaggactcaga
tttgctatccgcgaaggcggaagaacagttggtgcaggttctgttacaacaataattgaa
taa

DBGET integrated database retrieval system