KEGG   Caldisphaera lagunensis: Calag_1450Help
Entry
Calag_1450        CDS       T02380                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
clg  Caldisphaera lagunensis
Pathway
clg03030  DNA replication
clg03410  Base excision repair
clg03420  Nucleotide excision repair
clg03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:clg00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Calag_1450
   03410 Base excision repair
    Calag_1450
   03420 Nucleotide excision repair
    Calag_1450
   03430 Mismatch repair
    Calag_1450
Enzymes [BR:clg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Calag_1450
    6.5.1.6  DNA ligase (ATP or NAD+)
     Calag_1450
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Calag_1450
DNA replication proteins [BR:clg03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Calag_1450
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Calag_1450
DNA repair and recombination proteins [BR:clg03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Calag_1450
   NER (nucleotide excision repair)
    Other NER factors
     Calag_1450
   MMR (mismatch exicision repair)
    Other MMR factors
     Calag_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AFZ71155
UniProt: L0ADP1
LinkDB All DBs
Position
1426000..1427832
Genome map
AA seq 610 aa AA seqDB search
MSKNQNDLPFREVAETFDSMEKITSRISLTQLLVKLIKDTPPEVIGKVVYLIQGRLGPDW
KDIPELGVGEKLIIQALSIAFGKTEQEVNKIYNSVGDLGKVAESFSQSKQKKSSLMAFIG
SESSYLTVGRVFDSFLKIAYSQGEGSRDLKLRLIAGLLKDAQPIEARYIVRFLEGRLRLG
IGDATILDALSISYGGSTSYREIVERAYNLRADLGEIAYIIATQGIESIKELKPEIGTPI
RPMLAERLSDPEEILQKVQGKGFVEYKYDGERGQFHKDGDNVRIFSRRLEDITDMYPDVV
EAIKNSVKSNKVIFEGEIVAYDTDTGELRPFQELMHRRRKYDIQKMVEEIPVKAFLFDVL
LNEDEDLTRKTLPYRRKILENIVNETDKINIAKYIETDDPKTLWNFFLTAISEGAEGVMV
KAIHDESIYRAGVRGWLWIKLKRDYKSEMTDTVDLVAVGGFYGRGRRGGKIGTLLFAAYD
PENDVFRTVCKVGSGYTDDDLNKMYDLFKPYIIDHKHPRVESSIEPDLWFEPVRVAEIIG
AELTLSPLHTCCYNKLKEGAGLSIRFPRFIRWREDKGPEDATTEEELIEMYNGQLKKIEE
KQTKEEVQGS
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaatcaaaatgatcttccttttagagaagttgcagaaacttttgatagtatg
gagaaaataacttccaggatatcattaacccaactactagtaaaactaataaaagatacc
cctcctgaagtcataggcaaggtagtgtatctaatccaaggtagactaggacctgattgg
aaggatatacctgagttaggagtcggtgaaaaattaattattcaagcattatcaattgca
tttgggaaaacagaacaagaagttaacaagatttataattctgttggtgatttgggaaaa
gtagctgaaagcttttctcaaagcaaacagaaaaaatctagtttaatggcatttattgga
agtgaaagtagttacttaactgttggaagagtttttgatagctttttgaaaatagcatat
tctcaaggagagggaagtagggatttaaaactaagacttatagcaggtttgttaaaagat
gctcagccaattgaagctagatatatagttagatttttggaaggaaggcttaggcttggg
ataggagacgcaacaatattagatgcgctttcaatatcttatggaggcagcacatcttat
agagaaatagttgaaagagcttataatttgagagcagatttaggggaaattgcatatata
atagctactcaaggtattgaatcaataaaagaattaaagccagagattggaactccaata
agaccaatgcttgcagaaaggcttagcgatcctgaggaaatactacaaaaagttcagggt
aagggttttgttgaatataagtatgatggggaaagagggcaatttcataaagatggagat
aatgtaaggatattctcaaggaggcttgaagatattacagatatgtatccagatgttgta
gaggcaattaaaaatagtgtaaaatctaataaggttatatttgagggagaaatagttgca
tacgatacagatactggggagttaaggcctttccaggaattaatgcatagaagaagaaag
tatgatatacaaaaaatggttgaagaaataccagttaaggcatttttatttgatgtattg
cttaatgaagatgaggatttaacaagaaaaacactgccttataggaggaaaattttagaa
aatatagttaatgagactgataaaattaatatagcaaagtatattgaaacagatgatcct
aagacattatggaatttcttcttaacagctatatctgaaggagctgaaggggttatggta
aaagcaattcatgatgaaagtatatatagagcaggtgtaagaggctggttatggattaag
cttaaaagagattataagagcgaaatgacagatacagttgatttggttgccgtaggaggc
ttttatggtaggggaaggagagggggtaaaataggtacactattgtttgctgcatatgat
cctgaaaatgatgtttttagaactgtatgtaaagtaggaagtgggtataccgatgatgat
ttaaataagatgtatgacctgttcaaaccttacataatagatcataagcatccaagagtt
gagtcaagcattgaaccagacttatggtttgagccggtaagggttgcagaaattattgga
gctgaacttacattatctcctttacatacttgttgctataataaattaaaagaaggagca
ggcctttctataagattcccaaggtttataaggtggagagaagacaaaggtcctgaagat
gcaactacggaagaagaattaatagaaatgtataatgggcagttgaagaaaattgaagag
aaacaaactaaagaagaggtccaaggaagctaa

DBGET integrated database retrieval system