Canis lupus dingo (dingo): 112655353 Help Entry 112655353         CDS       T08371                                  Name (RefSeq) C-C motif chemokine 7-like   KO K05509   C-C motif chemokine 7 Organism clud  Canis lupus dingo (dingo) Pathway clud04060   Cytokine-cytokine receptor interaction clud04061   Viral protein interaction with cytokine and cytokine receptor clud04062   Chemokine signaling pathway clud04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112655353    04061 Viral protein interaction with cytokine and cytokine receptor     112655353  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     112655353    04062 Chemokine signaling pathway     112655353  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112655353 Cytokines and neuropeptides [BR:clud04052]  Cytokines   Chemokines    112655353 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  112655353 NCBI-ProteinID:  XP_025296206 Ensembl:  ENSCAFG00020014205 LinkDB All DBs Position 9:complement(40188098..40190091) Genome browser AA seq 99 aa AA seqDB search MKVSAALLCLLLTAAALTTQVLTQPDGINISTTCCYRFTTRKIPIQKLKSYRRITSSYCP REAVIFKTKLAKDVCADPNQKWVQDHMKYLDKKTQAPKL NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagcgctcctctgcctgctgctcacagccgccgccctcaccacccag gtgctcacccagccagacgggattaatatctcaaccacctgctgctatagatttaccact aggaagatccccatccagaagctgaagagctacagaagaatcaccagcagctattgtccc cgggaagctgtgatcttcaagaccaaactggctaaggacgtctgtgctgaccccaaccag aagtgggtccaggatcacatgaagtacctggacaagaaaacccaagccccaaagctgtga

DBGET integrated database retrieval system