Canis lupus dingo (dingo): 112663188 Help Entry 112663188         CDS       T08371                                  Symbol FGF4 Name (RefSeq) fibroblast growth factor 4   KO K04358   fibroblast growth factor Organism clud  Canis lupus dingo (dingo) Pathway clud04010   MAPK signaling pathway clud04014   Ras signaling pathway clud04015   Rap1 signaling pathway clud04020   Calcium signaling pathway clud04151   PI3K-Akt signaling pathway clud04810   Regulation of actin cytoskeleton clud05200   Pathways in cancer clud05207   Chemical carcinogenesis - receptor activation clud05218   Melanoma clud05224   Breast cancer clud05226   Gastric cancer Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112663188 (FGF4)    04014 Ras signaling pathway     112663188 (FGF4)    04015 Rap1 signaling pathway     112663188 (FGF4)    04020 Calcium signaling pathway     112663188 (FGF4)    04151 PI3K-Akt signaling pathway     112663188 (FGF4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112663188 (FGF4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112663188 (FGF4)    05207 Chemical carcinogenesis - receptor activation     112663188 (FGF4)   09162 Cancer: specific types    05226 Gastric cancer     112663188 (FGF4)    05218 Melanoma     112663188 (FGF4)    05224 Breast cancer     112663188 (FGF4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112663188 (FGF4)    00536 Glycosaminoglycan binding proteins [BR:clud00536]     112663188 (FGF4) Cytokines and neuropeptides [BR:clud04052]  Cytokines   Growth factors (RTK binding)    112663188 (FGF4) Glycosaminoglycan binding proteins [BR:clud00536]  Heparan sulfate / Heparin   Growth factors/receptors    112663188 (FGF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  112663188 NCBI-ProteinID:  XP_025307547 Ensembl:  ENSCAFG00020015404 LinkDB All DBs Position 18:48329427..48333304 Genome browser AA seq 206 aa AA seqDB search MAGPGAAAAALLPAVLLAVLAPWAGRGGAAAPTAPNGTLGAELERRWESLVVRSLARLPV AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTSDSLLELSP VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTEECKFKEILLPNNYNAYECYRYPGMFIA LSKNGKTKKGSRVSPTMKVTHFLPRL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcggggcccggggcggccgcggcggcgctgctcccggcggtcctgctggcggtgctg gcgccctgggccggccgcgggggcgccgccgcccccaccgcccccaacggcacgctgggc gccgagctggagcgccgctgggagagcctggtggtgcgctcgctggcgcgcctgccggtg gccgcgcagcccaaggaggcggccgtccagagcggcgccggcgactacctcctgggcatc aagcggctgcggcggctctactgcaacgtgggcatcggcttccacctccaggtgctcccc gacggccgcatcggcggcgtgcacgcggacacgagcgacagcctgctggagctctcgccg gtggagcggggcgtggtgagcatcttcggcgtggccagccggttcttcgtggccatgagc agcaagggcaagctgtacggctcgcccttcttcaccgaggagtgcaagttcaaagagatc ctgctccccaacaactacaatgcctacgagtgctacaggtacccgggcatgttcattgcc ctgagcaagaacgggaagaccaagaaagggagccgagtgtcccccaccatgaaggtcacc cacttcctccccaggctgtga

DBGET integrated database retrieval system