Cyclopterus lumpus (lumpfish): 117731941 Help Entry 117731941         CDS       T09199                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum04010   MAPK signaling pathway clum04012   ErbB signaling pathway clum04068   FoxO signaling pathway clum04137   Mitophagy - animal clum04140   Autophagy - animal clum04150   mTOR signaling pathway clum04210   Apoptosis clum04218   Cellular senescence clum04370   VEGF signaling pathway clum04371   Apelin signaling pathway clum04540   Gap junction clum04625   C-type lectin receptor signaling pathway clum04810   Regulation of actin cytoskeleton clum04910   Insulin signaling pathway clum04912   GnRH signaling pathway clum04914   Progesterone-mediated oocyte maturation clum04916   Melanogenesis Brite KEGG Orthology (KO) [BR:clum00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117731941 (kras)    04012 ErbB signaling pathway     117731941 (kras)    04370 VEGF signaling pathway     117731941 (kras)    04371 Apelin signaling pathway     117731941 (kras)    04068 FoxO signaling pathway     117731941 (kras)    04150 mTOR signaling pathway     117731941 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117731941 (kras)    04137 Mitophagy - animal     117731941 (kras)   09143 Cell growth and death    04210 Apoptosis     117731941 (kras)    04218 Cellular senescence     117731941 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     117731941 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117731941 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117731941 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     117731941 (kras)    04912 GnRH signaling pathway     117731941 (kras)    04914 Progesterone-mediated oocyte maturation     117731941 (kras)    04916 Melanogenesis     117731941 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clum04131]     117731941 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:clum04031]     117731941 (kras) Membrane trafficking [BR:clum04131]  Endocytosis   Macropinocytosis    Ras GTPases     117731941 (kras) GTP-binding proteins [BR:clum04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117731941 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin nSTAND3 Motif Other DBs NCBI-GeneID:  117731941 NCBI-ProteinID:  XP_034390403 Ensembl:  ENSCLMG00005022696 LinkDB All DBs Position 6:15527111..15537635 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYNLVREIRLYRLNKLSKEEKTPRC VKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatataagctggtagtggtgggagctggtggcgttggcaagagcgcacttact attcagctcatccagaatcactttgtggatgaatatgaccccactattgaggactcttac agaaagcaggtagtgatcgatggagagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggatcagtacatgaggacaggggagggcttcctctgt gtttttgccatcaacaacaccaagtccttcgaagacattcaccactatagagaacagatt aagcgggtgaaggactctgaggacgtcccaatggtgttggtggggaacaagtgtgacctc ccgtcccggacagtggacaccaagcaggctcaggacttagcacgcagctacggcattccc tttatcgagacctcagccaaaaccagacagagagtggaagatgccttttacaatctggta cgggagatcaggctgtaccggctcaataagctcagcaaggaagaaaagactccgcgctgt gtcaagcttaaaaagtgtgttgtgatgtga

DBGET integrated database retrieval system