KEGG   Clavispora lusitaniae CBS 6936: A9F13_06g01397Help
Entry
A9F13_06g01397    CDS       T05147                                 

Definition
(GenBank) putative L-aspartate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:clus00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    A9F13_06g01397
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A9F13_06g01397
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A9F13_06g01397
   00430 Taurine and hypotaurine metabolism
    A9F13_06g01397
Enzymes [BR:clus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A9F13_06g01397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 504 aa AA seqDB search
MISSDLETDRVQELDQLLSLIHPRIVDYVASADANSEKFQANSLGSFHEPSELKKIFTSE
EGIFERGLKNDHDSLFHHIDNVLKYSVNTWNPGFLDKLYASNNPIGVISDIILSVLNTNS
HVYTVSPVLSVLENYMGRKYARLFYSNHQDTCGGLTFSGGSWSNITAMQIARSIKYPETK
LHGNGNFKFAVYASKHCHYSIEKAAILLGIGSKSVFKVDINSDGTMNTRSLEETIQKSIS
EGYTPLFINTTAGTTVFGSYDDIQAASAIAKKFNVWLHVDGSWGGNVIFSEVHKKKLKGS
EFADSITTNPHKMLGTPNTCSFLLLPDVKTFQTANSLAAPYLFHGRENDEENMDLADGTM
GCGRRADAFKFYLTWLYYGYDGLQQRVDHAFRIVEYFVQSITNLPGFTLVDEHPQCLQVC
FYYRPEGYEGDDMTNITRFISRTLHSQGRYLMDFSPNPTKDEKGEFFRVVFNSPILTDKI
IDDLVASIVSVGAAYQKKMGQSKN
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgatctcatctgatttagaaacggatagagtccaggaacttgaccagttgttgtcactt
atccatcctaggatagtagactatgtcgcctcggctgatgccaattccgaaaaattccaa
gctaactctttaggaagcttccacgaaccgctggaactaaagaaaatattcaccagcgag
gaagggatattcgagcggggcttgaagaacgatcacgatctgctattccaccacattgac
aacgttttgaaatactcagtaaacacatggaaccctggatttcttgacaaactttatgca
tccaataatccgattggtgtaattagcgacataattttgtcagttcttaacacgaattct
cacgtttacactgtctctccagtcctctccgtcctagaaaactatatgggcagaaagtac
gcgagactcttttatctgaatcaccaagacacatgcggcggtctcacattctctgggggc
tcatggtctaacattactgccatgcaaatcgccagatcaattaaatatcctgagacgaaa
cttcatggcaatggtaatttcaagttcgctgtttatgcttctaagcactgtcactactct
attgaaaaagctgcaattcttcttggtattggatcaaagtccgttttcaaagttgatatc
aattcggatggaacaatgaacactcgttctcttgaggaaacgattcaaaaatcaatttcg
gaaggttatacgccgcttttcatcaacacgactgcgggtacaactgttttcggactgtac
gacgatattcaagccgcttctgccattgcaaaaaaattcaatgtatggttacatgttgat
ggttcttggggtggtaatgttattttctctgaggttcacaagaaaaagctaaagggcagc
gagtttgcagactccatcactacgaacccgcacaaaatgcttggaactccaaacacatgt
tcatttcttttgcttccagatgtgaaaactttccaaacagcaaactcgcttgctgcacca
tatcttttccacggaagagagaatgacgaagaaaacatggacttggcggatggaaccatg
ggatgtggacgaagagcagatgcattcaagttctacttaacttggctctactatggttac
gatggcttgcagcagcgtgttgaccatgcttttcggattgtggagtattttgtgcaaagc
attactaatttgccagggtttactttggtagacgaacacccccagtgtcttcaggtttgc
ttctactatagaccggagggatatgaaggagatgatatgacgaatattactagattcatc
tcacgtactctccattcccaaggaagatacttgatggacttttcgccaaatccaacaaag
gatgaaaagggtgaattcttccgtgtggtgttcaactctccaattctcacagacaagatc
atagacgacttggtggcaagcattgtttccgttggagccgcataccaaaaaaaaatgggc
caactgaaaaattag

DBGET integrated database retrieval system